SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025901|ref|YP_909746.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|119025901|ref|YP_909746.1|
Domain Number - Region: 79-111
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.017
Family Inhibitor of apoptosis (IAP) repeat 0.0059
Further Details:      
 
Domain Number - Region: 701-787
Classification Level Classification E-value
Superfamily PUA domain-like 0.0534
Family Atu2648/PH1033-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025901|ref|YP_909746.1|
Sequence length 818
Comment hypothetical protein BAD_0883 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTSRCRINVCDEVIWIRLNSPKILKPKNKLMGQRVMEKIDKTDTLRTILSGRKYTIDYFQ
REYRWGRKQIEQMLADFQNTFEEFYKPDDHDTPEEVMDYGFYYMGCIICTGGSIKKLIDG
QQRLTSLTLLIIYLNNLQKETVEDEDLIVPLDDMIFSKAFGKKSFNIDVEDRKPCMQALL
QKDQTYLPMSESVQNMLDRYQDIEDLFPDELKGEALPYFINWLIEKVLLLEIDTPSEDEA
HTIFLTMNDRGLSLNSAEMMKAFVIQHVAEEDRIKVNQEWQSNISRIKNASSYDTSGMVN
TQDVEFVSIWLRAKYANRMRDTKRGAKDEDYELLGDKFHAWVSNNARTVMGLAKPNDYKN
FVLTEMTRVTDVYLRMMDYGSKFTTGYEEVFYNANRDLTYQTMLAIAAIKNDDTDDIIQK
KIRMTAKFVDDFATIRILNFKKANWNTNKYQLFHVMQDIRNADCKTIGMVYVRALRRMGM
SVEGITRFGLNQFSKRYMLHILARFTSYVNVLMGNPSHFEEYVDRKRQGNTYDIEHILPD
KYEDYKDGFADLEDFESTRNLIGNLILLTRDKNRSYQAMKYSEKVQKYAGDNILAQALSS
TAYSKNPSFLSTVVAKYGFRDIPDFDRQSIVDRAEIYLKMASDIWNPNDIKNIAGGWDDD
EEKAFFKNEKGREFTIGYAERSWPDALKYGFLSASLGGSGKSIYNVQVGDTVYCYIAGCG
FVGIGKCTSTAVPMKNFKVMADGIPTPVSDASWQSEELKQKLDSNKEVFIGVAWKRSVTD
VDDGYWEKGMTTVPLAAYMLNDKTTYQKVKEHFGYTED
Download sequence
Identical sequences A1A1T1
WP_011743245.1.36503 WP_011743245.1.64668 gi|119025901|ref|YP_909746.1| 367928.BAD_0883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]