SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025929|ref|YP_909774.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025929|ref|YP_909774.1|
Domain Number 1 Region: 63-249
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.25e-17
Family RNA methyltransferase FtsJ 0.077
Further Details:      
 
Domain Number 2 Region: 9-58
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000000265
Family Pseudouridine synthase RsuA N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025929|ref|YP_909774.1|
Sequence length 251
Comment hemolysin-like protein [Bifidobacterium adolescentis ATCC 15703]
Sequence
MNDDSGAVVRLDIALVERGVTDSRSKAQRLIESGKVRVNGTVASKASLKVTAADTLDADL
GDDYVSRGAYKLVGAFDMFSQTGLRSAEGLDCLDIGASTGGFCDVLLRRGAAHVIALDVG
HGQLDPRIAGNERIIEMSGVNIRDVEADDLPYRPSMIVSDVSFISLTYVIPVIARIAAPG
AHVVLLVKPQFEVGKGNLGKNGIVESETLRKQALDTVTACAKANGLDVRATAVSPIEGTH
GNIEYLLYAVA
Download sequence
Identical sequences A1A1V9
NYSGXRC-11125m 367928.BAD_0911 gi|119025929|ref|YP_909774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]