SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025945|ref|YP_909790.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025945|ref|YP_909790.1|
Domain Number 1 Region: 245-438
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.18e-66
Family B3/B4 domain of PheRS, PheT 0.0000112
Further Details:      
 
Domain Number 2 Region: 508-626,656-759
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.45e-38
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00041
Further Details:      
 
Domain Number 3 Region: 769-866
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 5.62e-26
Family Anticodon-binding domain of PheRS 0.00066
Further Details:      
 
Domain Number 4 Region: 44-211
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.63e-25
Family Myf domain 0.0059
Further Details:      
 
Domain Number 5 Region: 443-516
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.97e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119025945|ref|YP_909790.1|
Sequence length 867
Comment phenylalanyl-tRNA synthetase subunit beta [Bifidobacterium adolescentis ATCC 15703]
Sequence
MVDIDWLKDHVEVPEGLTYEQLAKDLVKVGLEEEEIHTSQVTGPIVVGYVVDATPEPQKN
GKIINWCHVDVGDEYNETDENGNKVPRGIICGAPNMAAGEKVVVTLPGAVLPGDFKIEPR
KTYGHISNGMCASERELGLGDNHDGIILLRKYGFTPEEYEKLQPGDDAMHLLHLDQPLLE
INITPDRGYAFSYRGVAREYHHSTGAVYTDPATALGKKAPVTQGLPEGVKSDIEVIVDDK
NPIHGVVGCDRYYARAVRGFDPASHTPNWMRRRLIRAGMRSISLAVDVTNYVMLDLGQPM
HAYDLDKIEGPIVVRRANEGEKLTTLDGKDHDLSVEDLLITDSPNGERGSRVLGIAGVMG
GLYGEVTAETKNILLESAHFDQVSIARSARRHKIPSEASRRFERGVDDQLQPAAAQMAAE
LLVKYGNGEPSEHPTDYNTVCNRRPILFKASEVARVAGLDTDVNTISDILTDIGCTVAGG
GNGEFSVTPPSWRPDLNEPCDLVEEVARLVGYDEIPVTVPPAPVEGKVGLTAEQLRKRQV
ADELAEYGMVETLSYPFVGDEDYKNFALDADATKKVSVEIANPLAGDRPFLRRDIIPTLA
QTVQRNLRRGVENVSLYEIGHVYLWDPNAPAIPALPGAVKPTDEQLAALDAGLPDQPMHV
AGILTGNAVDSGWMGDRRAVDWSDAVEAVQRISDRIGAKLTLDQPKAEDVPAQWHPGRAA
RVMAGDTFVGMVGELHPHVNEALGFPAHSAAFELNLTALFATLSGKPVQAKPISTFPPVK
QDLAFTVSTDVTAAELEKTIVEAAGNSLESIDLFDVYTGDQLGEGLKSLAYAVTFRAEDK
TLTSEDSEAVRKRIVDAAAKLGAQLRA
Download sequence
Identical sequences A1A1X5
367928.BAD_0927 gi|119025945|ref|YP_909790.1| WP_011743284.1.36503 WP_011743284.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]