SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025994|ref|YP_909839.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|119025994|ref|YP_909839.1|
Domain Number - Region: 134-238
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0261
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025994|ref|YP_909839.1|
Sequence length 311
Comment phage AbiD protein [Bifidobacterium adolescentis ATCC 15703]
Sequence
MLKSGGSFFYQVAQGYAMTKQPKTIQEMMTLLVEERGLDITGFSDFSTVLLDCNYYRLSG
YFRAFQIDPSHGNNRFRNGTHIKDFMIPYLMDEQLRLLILRGTSSLEQTLRAHFAYYLAQ
NGGAYSYTELSSYKTIKYSDGTEAREVLIENIHKWLERSSEVCIRHYRNNNEPIPIWAAV
EAMPFDTLSKMISLHTNTTAVDELNQSLSLGKNRQRAAQIIHSMVYLRNICSHHCRLWNR
EIVLPPPVLDATAERYGSYAYEDRSVWKSLIVLMDLIDGIKKNSTYSSMLIKQAESNDNY
FWGLCHPKRWH
Download sequence
Identical sequences A1A224
388092 367928.BAD_0976 WP_011743340.1.36503 gi|119025994|ref|YP_909839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]