SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026006|ref|YP_909851.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026006|ref|YP_909851.1|
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily Trigger factor ribosome-binding domain 3.01e-33
Family Trigger factor ribosome-binding domain 0.00088
Further Details:      
 
Domain Number 2 Region: 247-396
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 8.24e-24
Family TF C-terminus 0.06
Further Details:      
 
Domain Number 3 Region: 137-246
Classification Level Classification E-value
Superfamily FKBP-like 6.09e-18
Family FKBP immunophilin/proline isomerase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026006|ref|YP_909851.1|
Sequence length 456
Comment trigger factor [Bifidobacterium adolescentis ATCC 15703]
Sequence
MKISVRNLEPTKVKLTVTVDPEEFNPYLDEARKEIAKQVNVPGFRKGHVPGKIIDQRIGF
GAVAGEAVNNGVPELYSKALETKKIHPMAQPEIDVQDVPESAKDETKLKFVATVERRPDI
ELPALDGMEIEVAKAEVTDEDINNRLEALRQRFGTLVSVDRPAAKGDYANIDLNAEINGE
TVDSQEGVSYELGSATMLDGLDEALEGLSAGEETSFEGTLEAGKHEGEKALIKVKVNSVK
AEELPELDDDFASEASEFDTLDELKEDLKKVAAQDAESRQATAARDAFIAKLEDGLEIPV
PKGVKAEMVEQQLKNVTADPSKATKEQKAEAEETVEKELRDQMVLDVLAETMDVKVSQGE
VFNFLASIAQQYGMDPNAFIQAIIRNGQIGSAVQEVGRSKGLLSGMRAVTFKSEGETLDL
SAFLGEAAEDEESESVEAASAAAAVADSLAADKDAE
Download sequence
Identical sequences A1A236
367928.BAD_0988 WP_011743352.1.36503 WP_011743352.1.64668 gi|119026006|ref|YP_909851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]