SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026007|ref|YP_909852.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026007|ref|YP_909852.1|
Domain Number 1 Region: 4-209
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.89e-45
Family DnaQ-like 3'-5' exonuclease 0.00029
Further Details:      
 
Domain Number 2 Region: 215-330
Classification Level Classification E-value
Superfamily HRDC-like 0.0000000000000206
Family HRDC domain from helicases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119026007|ref|YP_909852.1|
Sequence length 431
Comment hypothetical protein BAD_0989 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTDEPKLLAEPREGVPNVIDTLPAFRDYCSELASSHGSLAADAERASGFRYGHEDWLVQF
KRDGAGIGLLDPQALAAAGADWNDFNRAVGDAVWILHDSLQDLPGFDELGMEPQRLFDTE
IAARLLGLKRFGLAAVTEHFLGLTLAKEHSAADWSYRPLPRDWRNYAALDVELLIELETK
MRAELKRQGKMEWAQEEFDYALKEGLGPRKEHLIPWMHVSHITEVMRDRQALAIVRALWT
RRDELAREYDIAPTLLLSDSSIIEVAKRKPHNAAQFRSIRSINERVRIHTDSEQDKMFER
YAPIQRKIKPSMWKNIIQDALALPPSEWPDVDGGAARRHESQSASAPKSIRVWKERYPER
LQVLNRVRKAVSQIAEDTRTPVEIVIKPQYLRNLCWTDEPRKRDVARFLSEQGARDWQVS
LVAESVSRAII
Download sequence
Identical sequences A0A1X2ZY09 A1A237
gi|119026007|ref|YP_909852.1| 367928.BAD_0989 WP_011743353.1.36503 WP_011743353.1.55335 WP_011743353.1.55963 WP_011743353.1.6218 WP_011743353.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]