SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026073|ref|YP_909918.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026073|ref|YP_909918.1|
Domain Number 1 Region: 64-418
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.26e-38
Family (Uracil-5-)-methyltransferase 0.001
Further Details:      
 
Domain Number 2 Region: 3-62
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000201
Family TRAM domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119026073|ref|YP_909918.1|
Sequence length 421
Comment RNA methyltransferase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MESTIRIERYADQGRCVGHIDGRVVFVRFALPGELVRVVLDEPHDREDRFWTGEVTEVLE
ASEDRVEPVWPLAGPLAMGGGVGGADLVHVSLPGQLKWKSTSIAEQMRRLGHVDVDVPIE
RMPEDEAEQGLHWRTRIEMIADENGRPSMRRRGTHVRVPIDTMPLASRALLNVAEKEHVW
DGGFTPGSQIRLSVPEPRGNAEIADNYAVLVDGEVTAGNRELTEKVTVCGREFEYGVDAG
GFWQMHRHAPIALTGHVMSLVHGELDGATSACLWDLYSGSGLFTLPLATLSAGRTRMLSV
EGGKTAVKHAQRNLRAIHLGNVDARVGDVAKTLANVRNDLAKPDIVVLDPPRAGARAKVC
RQIAESGARSVVYIACDPASLARDTATLASLGYDLADIRAFDIYPTTHHVETVALFRKAT
R
Download sequence
Identical sequences A1A2A3
367928.BAD_1055 gi|119026073|ref|YP_909918.1| WP_011743411.1.36503 WP_011743411.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]