SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026119|ref|YP_909964.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026119|ref|YP_909964.1|
Domain Number 1 Region: 5-389
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.43e-90
Family Peptidoglycan biosynthesis glycosyltransferase MurG 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026119|ref|YP_909964.1|
Sequence length 393
Comment undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MSNQKHIVLAGGGTAGHVNPLLAVAHVIRELEPEADIAVVGTAVGLERDLVPQAGFELET
IEKVPFPRRPNKAALQFPAKWKAEKAKVRDILTRHQAQVVVGFGGYTSAPVYAAAHSMGI
PIAIHEQNARAGMANKLGARWASMIGAAYAQPGLKPRRGVEVERVGLPLRPAIARLASDL
EHDRTATRKAAAAQLGVDPDRPLVVITGGSLGAVNVNRAVAASAKDLLAHAQVIHLTGKG
KDDEVRSLVSVSAGEDVLGELGPDHVSDGDYRVAPYLERIDLAFACADLIICRSGAGTVS
ELTALGLPAIYVPLPIGNGEQRFNAQPVVDAEGGLMVADGDFTPDWVRGHVPELLADPDK
LSRYGANAWKYGIRDAAEVMAKRVLALIDQPAD
Download sequence
Identical sequences A0A076JMX7 A0A087DQ55 A1A2E9
WP_011743443.1.16084 WP_011743443.1.31140 WP_011743443.1.31393 WP_011743443.1.36503 WP_011743443.1.38945 WP_011743443.1.43097 WP_011743443.1.51786 WP_011743443.1.54320 WP_011743443.1.55335 WP_011743443.1.5662 WP_011743443.1.64668 WP_011743443.1.68247 WP_011743443.1.81525 gi|119026119|ref|YP_909964.1| 367928.BAD_1101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]