SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026134|ref|YP_909979.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026134|ref|YP_909979.1|
Domain Number 1 Region: 19-218
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 6.15e-43
Family Cation efflux protein transmembrane domain-like 0.0072
Further Details:      
 
Domain Number 2 Region: 222-301
Classification Level Classification E-value
Superfamily Cation efflux protein cytoplasmic domain-like 0.000000000000209
Family Cation efflux protein cytoplasmic domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026134|ref|YP_909979.1|
Sequence length 313
Comment cation efflux protein [Bifidobacterium adolescentis ATCC 15703]
Sequence
MAHNHAGVDATTAASGAEHQKRLMMSLGLTSTVFIAEVVSAIVTGSLALLVDAGHMLTDM
SVLIASTVTAVLMQRKPSNKRTWGWARLEVLTAAVGALVLLIVGIYALVEAGMRLFGGAA
DEVHDVRLLLFMGILGLAANVGSIFILAGQSEDNMNMKAAFLEVMNDALGSVAVIVSAIV
LISTGWAGFDAVAGGIIALMMIPRAFVLLRNAVRVLLEETPQELDLDEVREHLEQVPHVV
AVHDLHASTVSTGMPVVMAHVVVERGLTMDDAADVLSQLQNCLREHFPVSVPHTTFQLEP
EGYDSDSRKELHF
Download sequence
Identical sequences A1A2G4
gi|119026134|ref|YP_909979.1| WP_011743455.1.36503 WP_011743455.1.64668 367928.BAD_1116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]