SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026137|ref|YP_909982.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026137|ref|YP_909982.1|
Domain Number 1 Region: 17-190
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.67e-30
Family Hypothetical protein MJ0882 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119026137|ref|YP_909982.1|
Sequence length 203
Comment hypothetical protein BAD_1119 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MAQAEQYFAAEPQSKDVRKTLHVTLRGNEADVEVSNGVFSGNRVDLGTSVLLRQAPEPPE
EGTFLDLGCGWGPIALALGFASPKADIWALDVNERALELTRRNAELNGMGNIHAATADGI
PAETTFDLIWSNPPIRVGKEVLHTLLMTWLPRLNAGGAAYLVVQKNLGSDSLIPWLATQL
GDGYEVSKYASSKGFRVIEVMKA
Download sequence
Identical sequences A0A173X9X5 A1A2G7
gi|119026137|ref|YP_909982.1| 2004006102 WP_011743458.1.31393 WP_011743458.1.36503 WP_011743458.1.55335 WP_011743458.1.64668 367928.BAD_1119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]