SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026157|ref|YP_910002.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|119026157|ref|YP_910002.1|
Domain Number - Region: 282-354
Classification Level Classification E-value
Superfamily Sema domain 0.0392
Family Sema domain 0.01
Further Details:      
 
Domain Number - Region: 38-107
Classification Level Classification E-value
Superfamily Release factor 0.0589
Family Release factor 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026157|ref|YP_910002.1|
Sequence length 383
Comment hypothetical protein BAD_1139 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MLYHNPNSRGRRNVLRIVGVLVVLAVIASVANFLRTTTSDAVSNVKPQIETMQDIRQTAQ
DSITFAQSLDDPDQFAAHIETVQQYMDDYDRLADTKQIKYLLSDNPQERIIGLLYRDQQR
TIIDSMRVAAHNLDAQTKELLSAVDAAMADDFSQHAAQWLLQVDDPTQVNELIDRYGKQR
EYSSMREMLTGLESLHKLRSDVKQQVSSAVSNLHSEEASAAAIAVPERNGDLDPAGWYTL
ATNVVSTMGVQIEQTMEFNCGGQSGENPNGFVAAYYCQMPDRTQRDVVHILTTHPGWTQT
ARSPWLVDMVKHELSHRSIMVSCGTTQPTIAADRTEAVTNSYSVLFFGADRNRIADQQQG
VAEYAMDAHSDQLATAIHDGNCG
Download sequence
Identical sequences A1A2I7
367928.BAD_1139 WP_011743473.1.36503 WP_011743473.1.64668 gi|119026157|ref|YP_910002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]