SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026163|ref|YP_910008.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026163|ref|YP_910008.1|
Domain Number 1 Region: 9-237
Classification Level Classification E-value
Superfamily Thiamin phosphate synthase 1.7e-44
Family Thiamin phosphate synthase 0.0000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119026163|ref|YP_910008.1|
Sequence length 251
Comment bifunctional protein thiEC [Bifidobacterium adolescentis ATCC 15703]
Sequence
MNNYPFASMRDCFDMSAYFVVGPQDCKGRPVTDVVDDALRGGATFIQLRAKNADAKDITE
MARDIAQVIKNSGKSDSVAFVIDDRVDVVWQARDKGIKVDGVHIGQTDMEPQEARALLGE
DAIVGLSAETESLVKLINELPSGCIDYIGAGPLHVSTTKPEASVGGNDGSGHTLDEEQIN
AICAASEFPVVVGGGVHADDMEMLARSKAAGWFVVSAIAGADDPEAATREMVTRWKAVRG
DAKHGYAPRVK
Download sequence
Identical sequences A0A076JNN6 A0A087DNU6 A1A2J3
WP_011743479.1.16084 WP_011743479.1.23347 WP_011743479.1.24652 WP_011743479.1.31140 WP_011743479.1.31393 WP_011743479.1.3372 WP_011743479.1.36503 WP_011743479.1.38945 WP_011743479.1.43097 WP_011743479.1.51786 WP_011743479.1.54320 WP_011743479.1.5662 WP_011743479.1.64668 WP_011743479.1.74636 WP_011743479.1.76728 WP_011743479.1.90122 WP_011743479.1.92700 gi|119026163|ref|YP_910008.1| 367928.BAD_1145 NYSGXRC-11106o

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]