SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026192|ref|YP_910037.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026192|ref|YP_910037.1|
Domain Number 1 Region: 31-86
Classification Level Classification E-value
Superfamily YefM-like 0.0000000419
Family YefM-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119026192|ref|YP_910037.1|
Sequence length 112
Comment hypothetical protein BAD_1174 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MRFQISQRRNMSAASILDSMVSVTSLNHGGASKALSQVGDNHPVVVLKNNQPSAVIITPA
DYRRLTQAEENFALYRKAVERLRNDDSTLLTDADVFGEDYEPIDDGFEPEFE
Download sequence
Identical sequences A0A1E7Y1H3 A1A2M2 A7A8X0
367928.BAD_1174 WP_003810962.1.23347 WP_003810962.1.31140 WP_003810962.1.36503 WP_003810962.1.47152 WP_003810962.1.49252 WP_003810962.1.64668 WP_003810962.1.88872 392726 gi|119026192|ref|YP_910037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]