SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026215|ref|YP_910060.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026215|ref|YP_910060.1|
Domain Number 1 Region: 40-410
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.58e-106
Family NagZ-like 0.00000072
Further Details:      
 
Domain Number 2 Region: 412-491,526-689
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 9.68e-41
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119026215|ref|YP_910060.1|
Sequence length 809
Comment beta-D-glucosideglucohydrolase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MSSCGCAYDILKYQLVIKGNRFNEESEQSMTETTENTVNLPYRNPKLPTEERIADLLGRM
TLEEKVGQMMQLDARSGDLDDLIVNKHVGSILHTSPSDLPKAVETVNAKTRLGIPLVIGD
DCIHGYSFWPGATIFPEQLGMATTWDSEKVQAAGRATAEEVSATGVHWTFSPVLCIARDT
RWGRVGETFGEDPYLIGEMASSIVKGYQGGAKAGEPLAKDAILACAKHFAGYSETQGGRD
ASEADLSHRKLESWFLPPFERVAKEGCGTFMLGYESIEGVPVTFNKWLLSDKLRGAWNYQ
GTLITDWDNVGRSVWEQKVKPDYVQAAADAVKSGNDLVMTTPKFYEGAIEAVKTGLLDES
LIDAAVARILALKFRLGLFEDPRLPDQKRIDAVIGSEEHQQLNLEVAREAVALLKNDGSL
PFNVAGAKRIAVVGPLADDVQTQLGDWAGSSGQINWMPDGHPREMITTVLDGFKQLAPEG
CEVVYSRGANIVDLVPDPEGEFYPDGQPRPKIGVSAKIDRALLGEAVENARKSDLIVAVV
GDVIQAIGEGCSTATLELLGGQNALIDALSNVARETGKPFVVVLVSSKPQVLPASVIGTN
GVIVDETPAEGTSALLWAPSPGMKGGQAIAEIILGETEPSGRLPITFPRHAGQLPVYYNQ
IRGQHGNRYADLTQNPAFAFGEGLSYTTFEYGDPTITNVPESGIFAETDTVHAEITLTNT
GDRKGTEVVQLYIGDIVTSYSWTDRELKAFQRVELEPGKSKTVAFDIPVSDCTIVDSEAN
RIVEPGEFEVLIGHSSRREHLKRTTFTVA
Download sequence
Identical sequences A1A2P5
367928.BAD_1197 gi|119026215|ref|YP_910060.1| BdR12 WP_011743522.1.36503 WP_011743522.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]