SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026251|ref|YP_910096.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026251|ref|YP_910096.1|
Domain Number 1 Region: 4-219,266-417
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.99e-60
Family C5 cytosine-specific DNA methylase, DCM 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119026251|ref|YP_910096.1|
Sequence length 424
Comment modification methylase Sau3AI [Bifidobacterium adolescentis ATCC 15703]
Sequence
MSKEIKVVELFAGVGGFRLGLDGYSNPKYPDFEMKPAGNFHTVWANNWEPDGRPTKQFAW
RCYEKRFGEGSCVNEDIAVVVEQIKNGERELPEFDMLVGGFPCQDYSVAKPASLASGIEG
KKGVLWWSINAILEMRHPKYVLLENVDRLLKSPTAQRGRDFAIILSCLYRLGYSVEWHVV
NAADYGMPQRRRRVYIYAEHDAPKWDLENQLFHVGVEARAFPIEPDERFGAERFSVSKDP
YRSTKEFGIGDKISRFKEAGVMQNGKVLTRRVKPIYNGPQRTLGEFLVPIEQVPEEFFIT
GDNLKSWEYLKGGKHEKRTASNGHEYVYSEGPIAFPDPLDKPSRTILTGEGGRGASRTKH
VVMQNGRLRRLVPDELDQLQRFPKGWTDDGMTDGHRAFCMGNALVTEIPHRIGKVIAEDN
DSKR
Download sequence
Identical sequences A0A1V8Q880 A1A2T1
gi|119026251|ref|YP_910096.1| WP_011743555.1.36503 WP_011743555.1.64668 WP_011743555.1.92700 367928.BAD_1233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]