SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026301|ref|YP_910146.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026301|ref|YP_910146.1|
Domain Number 1 Region: 71-379
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.03e-94
Family C5 cytosine-specific DNA methylase, DCM 0.00000273
Further Details:      
 
Domain Number 2 Region: 4-58
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000041
Family SinR domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026301|ref|YP_910146.1|
Sequence length 383
Comment DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC 15703]
Sequence
MVDTDYGQQIKDKRERLHMTQKELADAIGLSKNGDRTIRRWENGESKPTEPEFRQIMEFP
ENAPFKNPDEADYRSIDLFAGIGGTRLGFQETGRVKVVFSSEINKFSAKTYHANFGEYPA
GDITQIAASDIPDHDILVGGFPCQAFSQAGLKKGFEDARGTMFFEIARILKEKRPKAFLL
ENVKNLVGHDHGNTFRTIKSILEGLGYAVNAKVLAAKDFGVPQNRERIYIVGFDKEQVPN
WADFKYPEPPCIPTRLGDILEKNVDDKYTISDALWAGHQRRKQENKKAGKGFGYGLFDED
SPYANTISARYYKDGSEILIRQDGKNPRKLTPREASRLQGFPPEFIIPVSDTQAYKQFGN
SVAVPVVNAVAKQLLKVLDASKE
Download sequence
Identical sequences A1A2Y1
WP_011743605.1.36503 WP_011743605.1.64668 367928.BAD_1283 gi|119026301|ref|YP_910146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]