SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026302|ref|YP_910147.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026302|ref|YP_910147.1|
Domain Number 1 Region: 20-154
Classification Level Classification E-value
Superfamily Resolvase-like 3.92e-47
Family gamma,delta resolvase, catalytic domain 0.0000535
Further Details:      
 
Domain Number 2 Region: 157-199
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000323
Family Recombinase DNA-binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026302|ref|YP_910147.1|
Sequence length 204
Comment DNA invertase-like protein [Bifidobacterium adolescentis ATCC 15703]
Sequence
MFRNSMPLTGSGMVGRMASMIYGYARVSTNDQTTNLQKDALEKAGCDRIFTEVASGAKAH
RPELDHMLDLLREGDTVVVWKLDRLGRSMQNLVDLMTTFDERGVQFRSLTESIDTNTPGG
TLVFNIFGSLAQFERDLIRERTRAGLEAARARGRKGGRPAKLDEKQVREVRRLYESRTVT
VDQIATMMGVGRSTIYRCLNTSDK
Download sequence
Identical sequences A1A2Y2
WP_011743606.1.36503 WP_011743606.1.64668 gi|119026302|ref|YP_910147.1| 367928.BAD_1284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]