SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026328|ref|YP_910173.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026328|ref|YP_910173.1|
Domain Number 1 Region: 12-293
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-54
Family Protein kinases, catalytic subunit 0.0000452
Further Details:      
 
Weak hits

Sequence:  gi|119026328|ref|YP_910173.1|
Domain Number - Region: 397-424
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0224
Family Myosin S1 fragment, N-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026328|ref|YP_910173.1|
Sequence length 473
Comment serine_threonine protein kinase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MEASRSIPPQIPGYTLIKRLGSGSEADVYLYQQLSPARQVAIKISKNTLDPRAAVRFRSE
ANFMGQISTHPYILSVYENGVTVNGRGYTVFEYAPGGNYKTFLEHGRLTADQMLTVGIDL
ASALFTAHRKGIIHRDIKPSNILINAHNMPMLADFGIAGTVYGRPGVGFTIAWAAPEVLA
QGGGGNESSDIYSLGATLFAMLIGQSPYEYFYADVLGDSQRQVRAERLKSVILNNPLPKL
NRSDVPAEVEWVLRKALSRAPEDRYYSALEFARDMQRVQQALYGRAVQTTVEGVPDYPQN
MYAQTSTFDQSAPVAKQHARWVKPLAVTVAAAAAVVVMALAFVTVVMPNMDAASDNSKVQ
VQNHGAQNHAEDDPDSAITSGSVPSVQDLTGEYTADSKVRFTWVNPSPKDGDSYAWSLVG
DSGTDPNAQGTTTESTSIEIDPADGAQTCVQVSLVRADRQMSENPMIACAAKP
Download sequence
Identical sequences A1A308
gi|119026328|ref|YP_910173.1| 367928.BAD_1310 WP_011743628.1.36503 WP_011743628.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]