SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026335|ref|YP_910180.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026335|ref|YP_910180.1|
Domain Number 1 Region: 113-220
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000249
Family FHA domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026335|ref|YP_910180.1|
Sequence length 222
Comment hypothetical protein BAD_1317 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MEYASIVLQNEYRQTAWTSPFYNGNMSFLPYPPPPEPGWYDDDVTVMAQPTAEPVDNAAD
SLETRERLAAQNESDDHDMQDVSVAKGDAAVSDEDDIDWDGTVLSEAFTMKQPKHTYVLD
NEQTGQQVIVDMGVLLGRKPSAEVPAGAKSVKLEDPTRTISRNHAAISFDQDGTLWIEDY
GSLNGTYIIQDDVETKVEHKPMQLEAPCTVRIGDQFFQFRKQ
Download sequence
Identical sequences A1A315
gi|119026335|ref|YP_910180.1| 367928.BAD_1317 WP_011743635.1.36503 WP_011743635.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]