SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026349|ref|YP_910194.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026349|ref|YP_910194.1|
Domain Number 1 Region: 9-210
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.62e-50
Family GHMP Kinase, N-terminal domain 0.0000647
Further Details:      
 
Domain Number 2 Region: 230-403
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.22e-43
Family Galactokinase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119026349|ref|YP_910194.1|
Sequence length 416
Comment galactokinase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTAVEFIEPLSHDEGVKNATDLFRATYGEEPAGVWAAPGRVNLIGEHTDYNAGLCLPIAL
PHRTFIALKPREDTKVRVVSDVDSGNVTEADLDGLQAGGVEGWAAYPVGVAWALREAGFD
AVQGFDAAFSSCVPLGSGLSSSAAMTCSTALALDDVYGLGYGASDAGRVTLINAAIKSEN
DMAGASTGGLDQNASMRCTFGHALRLDCRPELSPLENVSQQEFDLDKYGLELLVLDTQAP
HQLNDGQYAQRRATCEKAAEILGVANLRVVADSIAKSDDPFQALKETLDKLEDDTMKKRV
RHVITEIARVNSFVRAFANGKIDEAGRLFNASHDSLAADYEVTVPELDIAVDVARVNGAY
GARMTGGGFGGSIIALVDKGQGHEIAQKIADRFEKEGFNAPRALPAFAAASASREA
Download sequence
Identical sequences A0A174A9N3 A1A329
WP_011743648.1.31393 WP_011743648.1.36503 WP_011743648.1.64668 gi|119026349|ref|YP_910194.1| 367928.BAD_1331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]