SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026354|ref|YP_910199.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026354|ref|YP_910199.1|
Domain Number 1 Region: 67-295
Classification Level Classification E-value
Superfamily Lysozyme-like 6.75e-62
Family PBP transglycosylase domain-like 0.0000246
Further Details:      
 
Domain Number 2 Region: 255-274,311-718
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.89e-57
Family beta-Lactamase/D-ala carboxypeptidase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119026354|ref|YP_910199.1|
Sequence length 766
Comment penicillin-binding protein [Bifidobacterium adolescentis ATCC 15703]
Sequence
MGVMPKKKTLTVQRVLALVIAYITLCVGGGVVTSIFFMPAVFAANNAAKAVIPSLAVEGI
DFDVTSLPQRSTMYFNDGKTAFAEFYTQNREVVPLKKISKAMQQAVVAREDKRFFEHTGV
DVQGVFRAFFQTYVRGGDQQGGSTLTQQYVKNVLSTQAREDDDPIAEYHATEDTVARKLR
EMLISVQIEKKYSKAEILQGYLNIAQFGRNNLCGVEMAAKRYFNVSASELNVTQAATIAA
ITKNPQNFDPSVEANQKEAEHQRNIVLQLMHDQGYITSEKEFKDAINTPLKDTLNLQDVS
SGCQSAIENTGFFCSYVVNQILKNKAFGKDDEAREKLLKEGGLKIVTTLDRNANNAAMQA
ANSTVPATDPSGFEVMIAAVKPGTGEILSFGINRTYDATDDARTDETKTSMNYMVDQEDG
GGMGFNVGSTWKPINMVAWMQKGHSINESLVTSTVYDTSKFNCNGYGFVGPWRVQNSGGG
TTSPESPLQGLIKSHNTTQASMASNIGLCAIADAAKEMGYHNAISNASDIYSANSFQPPM
TIGTVQASPLTMANVYATMGANGVECTPIAITKVTDRSGSKVKVPSANCHQAIDPDIAQT
VSYALNQGIVQPGGEASTTQLDNNRKTFAKTGTNENTVMATAGFVPNQVAAFVAVADAQD
PINNTFDNKTINGVYRPSWYGMYIATPAWKQFMNTYLAAINAPIDNDYGKGADKYTVSKG
ATRTYNQYQYQRQQNSQQQSQQQTNQGQQQQSQQQPAEQQSDQQHQ
Download sequence
Identical sequences A1A334
WP_011743653.1.36503 WP_011743653.1.64668 gi|119026354|ref|YP_910199.1| 367928.BAD_1336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]