SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026405|ref|YP_910250.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026405|ref|YP_910250.1|
Domain Number 1 Region: 4-421
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.94e-53
Family Glycosyl transferases group 1 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026405|ref|YP_910250.1|
Sequence length 424
Comment spore coat protein [Bifidobacterium adolescentis ATCC 15703]
Sequence
MNPRVAVITSGYLPVPNVLGGAVEALDMMMVRENEKTANFEFTVFSSWAPGVDKIVRDGA
FQHTDFRFIKTPMLVKAADRCIYWAAKYILRKKKLMSYRYIAQRLWYIRKVAKALSKDDT
SGKAPFDKVMIENHATLFMTMQKYGNAERYADKVYYHLHNEVTNDFGCKHEIAQVKKVLG
VSNYIVDTLDKFLRKHGEGGLRSEQKAVWRNGVDTSRFGSEEADKKAQIFRKKYGIDKND
VVFLFSGRLTPEKGAEELLRAFSEVAEEISNAKLVVAGAFFFNSNIVSPFEQKLRDLASN
PGVKDRIIFTGFVDYDDMPAIYAMSDVCVLPSIWDDPAPLAVIESLVSGKPLITTRSGGI
PEYADNQSAIILERDDRLVDQLAEAMIELAQDSGKRAAMGAHAVTLRSELNKEMYMSQLS
GLMR
Download sequence
Identical sequences A1A385
367928.BAD_1387 WP_011743684.1.36503 WP_011743684.1.64668 gi|119026405|ref|YP_910250.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]