SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026436|ref|YP_910281.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026436|ref|YP_910281.1|
Domain Number 1 Region: 122-469
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.33e-80
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0058
Further Details:      
 
Domain Number 2 Region: 452-596
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.79e-26
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0009
Further Details:      
 
Domain Number 3 Region: 36-118
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 7.32e-21
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119026436|ref|YP_910281.1|
Sequence length 596
Comment arginyl-tRNA synthetase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MSPEALSELIFNIANTLVSEGKAGTLTADLIPPQAKFAVMRPKDRAHGDWASNAAMQLAK
KAGMKPRDLAELFAAELTNADGIKSVEVAGPGFINITLDSASAAAVVDTVLEAGSDYGKN
DHLSGKTLNLEFVSANPTGPIHIGGTRWAAVGDSMARVLEANGAKVVREYYFNDHGEQIN
RFAKSLVAAAHGEETPIDGYKGAYIDEIAKRVIDEANADGVDVLSLPRVDGGADQDGNPL
GEGDSEQREEFRKRAVPMMFDEIQRSMKNFRVNFDVWFHENSLYSDGEVDQAIADLRARG
DIFEKDGATWFESTKHGDDKDRVIIKSDGNYAYFAADIAYYRNKRHRETNPADVAIYMLG
ADHHGYIGRMMAMCEAFGDKPGENMQILIGQLVNVMKDGKAVRMSKRAGNVVTIDDLTDA
IGVDASRYSLARTDYNSPVDIDLNLLSSHSNENPVYYVQYAHARSCNVDRNAAAAGITYE
GADVSLLDTTADGEVLAALAQWPALLREAGDLRAPHRVAHYLEDLAATYHKWYNVERVVP
MELTDPEARGEQADAIRIAKAPEPARAAARLKLNDAVKTVIAEGLDLLGVTAPDKM
Download sequence
Identical sequences A1A3B6
gi|119026436|ref|YP_910281.1| WP_011743711.1.36503 WP_011743711.1.64668 367928.BAD_1418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]