SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026482|ref|YP_910327.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026482|ref|YP_910327.1|
Domain Number 1 Region: 159-568
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.8e-92
Family Extended AAA-ATPase domain 0.00000000171
Further Details:      
 
Domain Number 2 Region: 570-870
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-79
Family Extended AAA-ATPase domain 0.0000000071
Further Details:      
 
Domain Number 3 Region: 4-157
Classification Level Classification E-value
Superfamily Double Clp-N motif 4.19e-33
Family Double Clp-N motif 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119026482|ref|YP_910327.1|
Sequence length 905
Comment chaperone clpB [Bifidobacterium adolescentis ATCC 15703]
Sequence
MEQKFTQMAQEALSDAVQNAAALGNPQVDTLHLLDAMLRQENSMARALIEAAGGNAQNVS
AEVHQAMQSLPSASGSTTTQPDVSRQLSAVLSQAEKEMQRRGDEYVTVDLMLVAIAAAKP
NQSADILEKNGLTADKLRNALTAARGSDRKVTSADAEGSYKALEKYSTDLTAAAKEGKLD
PVIGRDQEIRRVIQILSRRTKNNPVLIGEPGVGKTAVVEGLAQRIVAGDVPTTLQNKKLI
SLDLGSMVAGSKYRGEFEERLKSVLEEIKKADGQIITFIDEIHTIVGAGAAEGSMDAGNM
LKPMLARGELRLIGATTLDEYRENIEKDPALERRFQQVFVGEPSVEDTVAILRGIAPKYE
AHHKVTIGDDALVAAATLSNRYISGRQLPDKAIDLVDEAAAHLRMELDSSPEEIDELRRQ
VDRLKMEKSYLLGNPKNDKATEKAEAELDDSAKDRLADLNQEIADKSEKLNGLKARWDAE
KNGHNRIGDLRKKLDELRTQAEKYEREGDLAKSSAINYGEIPAIQKEIAQAEKNEAESGG
ADNANADVPMVPDRVDADSIAEIVSDWTGIPVGRLMQGENEKLLHMEEYLGKRVIGQKEA
IQAVSDAVRRSRAGISDPNRPTGSFLFLGPTGVGKTELAKALADFLFDDEKAMVRIDMSE
YMEKASVSRLIGAAPGYIGYEEGGQLTEAVRRRPYSVVLFDEVEKANPEVFDVLLQVLDD
GRLTDGQGRTVDFKNTILIMTSNLGSQFLVNPDMDADAKKKAVMDAVHMQFKPEFINRLD
ELVMFHPLTREELGGIVDIQVAQVSARLTDRRITLDVTDSAREWLANTGYDPAYGARPLR
RLVQTEVGDQLARMLLAGEVHDGDTVLVDQTGGDHLELSAWAADQLEDMGEGKTDDSADV
PNPAE
Download sequence
Identical sequences A1A3G2
367928.BAD_1464 WP_011743752.1.36503 WP_011743752.1.64668 gi|119026482|ref|YP_910327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]