SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026553|ref|YP_910398.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026553|ref|YP_910398.1|
Domain Number 1 Region: 3-138,173-396
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.19e-91
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000198
Further Details:      
 
Domain Number 2 Region: 403-530,565-595
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 8.41e-34
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00022
Further Details:      
 
Domain Number 3 Region: 139-173
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0000000000471
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119026553|ref|YP_910398.1|
Sequence length 620
Comment methionyl-tRNA synthetase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MSHILVNVAWPYANGPRHIGHVAGFGVPSDVYARYERMKGNDVLMVSGTDEHGTPILVEA
DKEGVSAQELANRYNRVIAKDLCDLGLSYDLFTRTTTGNHEKVVQELFKQCLENGYIYKG
TQKVAISPSTGRTLPDRYIEGTCPICGADGARGDQCDACGNELDPDELLNPVSKINGETP
RFEETEHFFLDLPALAEANLAWLKTREGWRTNVINFSIGLFKEVKPRAITRDIDWGIPVP
VKGWIDNPNKKLYVWFDAVIGYLSASIEWARRKGDPEAWRAWWNDPTTPGYYFMGKDNIT
FHSQIWPSEMLAYNGQGSKGGETGKLGPLNMPEQVVASEFMTMEGKKFSSSRGIVIYVKD
ILARYPVDAVRYYISVAGPESSDSDFTWAEFVRHNNEELAASWGNLVNRVANLINKNFGE
IPAFDEASATDEDRALLAETKAAFETVGGLIENHRQKNALSEAMRVVGDINKYISATEPW
KIKDNPARLGTVLHTAAQAVSDANHLLAPFLPHSAQKVWEALGGTGVFSPLPRLEEVEDL
DKPGFTYPIITGDYKLGETVHPWASEPIVAGTSVPKPHPIFAKIPPEAVEEELARFDAEL
KARREAEAARLAAEKAKLEG
Download sequence
Identical sequences A1A3N3
BdR39 gi|119026553|ref|YP_910398.1| WP_011743834.1.36503 WP_011743834.1.64668 367928.BAD_1535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]