SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026616|ref|YP_910461.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026616|ref|YP_910461.1|
Domain Number 1 Region: 4-311
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.21e-85
Family NagZ-like 0.0001
Further Details:      
 
Domain Number 2 Region: 315-551
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 5.89e-47
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026616|ref|YP_910461.1|
Sequence length 811
Comment putative glycosyl hydrolase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MELEDLSIVEKAAMLSGGSEWDSRGNDRADIPGFVMSDGPHGVRRQLGEGDHLGIGASKP
ATCFPTACTVANTWDPALAEEMGEALGKEAHDLDVNVLLGPGMNIKRNPLCGRNFEYYSE
DPIVAGRMAAGLIRGIQSNGVSACPKHFAVNSQELRRQASNSVVDERTMRELYLTGFEIA
VREAKPMSIMTSYNEVNGVYAHENKHLLQEILRDEWGFDGMVVSDWGGSNSAVAAVKAGG
SLEMPSPGFTSVRELEGAVKAGALAEADINKRAAEVAKIAAATKLVGVGRDDLLSDDIAK
AHHDIARTVAEHSSVLLKNDAATLPLKPGTRVAVIGDMAATARYQGSGSSKVNATKEENI
LDEVKNAEGLVLAGYEQGYDRQGKSDEVLLNDAVALAKKDAVDVVLAVVGLDERSESEGL
DRSTMAIPQAQNDLVTALAKTGKPVVIVLVAGSPVELPWFNDVAAMLYVGLSGQAGASAT
VRALTGEVNPSGHLAETWPMQYEDCPSSGWYPAIGRDAIYREGPFVGYRYYETVGVPVRF
PFGYGLSYSTFTYSAITATATGVDFVVTNDSDVAGSTVAQLYVRAPQGGVLHPDRELKGF
VKVELAAHESKSVHIDFDRYTFRHFDVAANAWKTESGEWTLLVGDNAEHLPLAIPHTVAG
DCTTADCAADPALGHYLTGQVKDVTDAEMAVLFGHEVLAPGKPTTFGVNDPIMSWVDSKG
FVARTVAKTLTKREAKIRQKTGSPDLNTLFILNMPPRAMSKMTQGMVDSAMVDAIVNIAN
GHTFRGLGGVIAGFFRNQSANKRTAKELNHD
Download sequence
Identical sequences A1A3U6
BdR15 WP_011743890.1.36503 WP_011743890.1.64668 367928.BAD_1598 gi|119026616|ref|YP_910461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]