SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026620|ref|YP_910465.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026620|ref|YP_910465.1|
Domain Number 1 Region: 84-374
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.18e-82
Family N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain 0.0000349
Further Details:      
 
Domain Number 2 Region: 19-84,384-414
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.00000061
Family D-aminoacylase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119026620|ref|YP_910465.1|
Sequence length 415
Comment N-acetylglucosamine-6-phosphate deacetylase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MQADRVRETERINDAFLEEVVPFAVHGATIVDARGMTKNGWLVSDGRSIVETGCAETDFE
TACRLVHVEQDHIVNANGMVMTPGYVDIHSHGAWGSSFDDGEKGITTARAGHMAHGTTRQ
VLSLITNPIDVICGNLKTVHDMMPDRPDILGAHLEGPFLAMPRKGAHDPNCLVDPTPDLV
SRMLDAADGCLRQITIAPELPHGIDAIRRFFLAGVVPAVGHCDADYQTARKGFDAGAGIM
THMFNAMNGLHHRDPGPIPAAVEDPRVTIELINDGFHVQDPMVKLGFGLAPHRIAFVTDA
MAATDCPDGHYLLGALDVDVRDGHARLASNGAIAGSTLLLEKAVSRAVLELGISPVDAVE
AATLTPARAFGFDRRNDVTGFPIGLLAPGFAADVLLLDQETWTVRRVWCNGHPVR
Download sequence
Identical sequences A0A174BJ00 A1A3V0
WP_011743894.1.43097 WP_011743894.1.51786 WP_011743894.1.95811 367928.BAD_1602 gi|119026620|ref|YP_910465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]