SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026629|ref|YP_910474.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026629|ref|YP_910474.1|
Domain Number 1 Region: 565-842
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.11e-62
Family NagZ-like 0.0014
Further Details:      
 
Domain Number 2 Region: 41-109,141-274,336-350
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 1.57e-23
Family Beta-D-glucan exohydrolase, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119026629|ref|YP_910474.1|
Sequence length 904
Comment beta-glucosidase-related glycosidase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MMLTGPLSTLLNNATITKYTLSDATVSKANELAKDVQSEAVTLLKNDDSNLPLSGKKVNV
FGWGSTNPVYGGTGSGSMSKQYKTVSLLDGMKQAGLKTNTELSKLYTDYRKDRPEVGMFA
QDWTLPEVPAKQYSDKLVSDAKDFSDEAVVVLTRVGGEGADLPTDMKAKGITYKNNSKDY
DDFQKGESFLQLSKTERDMIDLVTSNFKKVTLVYNGANTFQFDFLNDYPQIQSVVWCPPA
GQTGFSALGEVLAGETNPSGKTSDTFLKDLTKSVSYNNFGKFEYTNMADKAAKYKGFTGD
DVTAIPGFVNYSEGIYVGYKFYETASDEGLINYDDTVAFPFGYGLSYTSFDQKLDSVKYK
GGKVTVTATVTNTGDKAGKDVVEAYYNPPYTDGGIEKASKNLAGFEKTKELQPGESQKVT
VKFDDDDMASYDYKGAKAYVLEKGDYDISIQSDSHHVIDHKAITVKDTVTYDSDSNTHNG
DKTVATNQFDDVAGDVTYLSRADHFANYKEATAAPTNFKMSDKAKETFYNNSNYDPKKFD
KDSDKMPTTGAKNGLKLSDMYGKDYDDADWDKLLDQLTFDDMDNLIANGGYGTQALKSVG
KIQLTDADGPASLNNNFTGVGSIGFPASTAFACTWNKDLAKQFGEMIGDMAHDMHVAGWY
APAMNIHRNAFSGRTFEYFSEDSLLSGVMASSEISGAKSKGVYSFMKHFALNDQETKRTE
MLCTWTNEQAMREIYLKPFEMSVKEGGAQAVMSSFNYIGNTYAGADSALLQTVLRGEWGF
KGFVLTDYFGGYGYQNADQEVRAGNDSMLATTKITNHITDKSATSVKAMRQAAHNILYTA
ANSWQYANGEPKVATPIWKTAMYVAWGVVAVLVIGLEFLTIKRYLSRKKAVATIEPAAEP
AQAE
Download sequence
Identical sequences A1A3V9
367928.BAD_1611 gi|119026629|ref|YP_910474.1| BdR17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]