SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026633|ref|YP_910478.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026633|ref|YP_910478.1|
Domain Number 1 Region: 26-299
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.43e-67
Family rRNA adenine dimethylase-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119026633|ref|YP_910478.1|
Sequence length 303
Comment dimethyladenosine transferase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTENVNEHTQGHLLGAADIRRIAADAGISPTKKFGQNFVIDPGTVRRIVREAGVTADDHV
LEVGPGLGSLTLAILETGATMTAVEIDPPVAERLPKTIAEFMPDAVDRFRVVNRDALTVN
PENLPDFKDDDSFTLVANLPYNVATPILLTLLERFDNLGTFLVMVQKEVADRLSEKPGSK
IYGTPSVKLAWYGTAERVGVIGRNVFWPAPNVDSALVLFKRYPGGHTPAADNADGSVVDR
ETVFRLIDAAFGQRRKTLHAALKKIVPSEAFEKAGIDPTRRGETLTIDEFVALARALDEV
FAS
Download sequence
Identical sequences A1A3W3
367928.BAD_1615 WP_011743906.1.31140 WP_011743906.1.31393 WP_011743906.1.36503 WP_011743906.1.51786 WP_011743906.1.54320 WP_011743906.1.55963 WP_011743906.1.6218 WP_011743906.1.64668 WP_011743906.1.74636 WP_011743906.1.92700 WP_011743906.1.95811 gi|119026633|ref|YP_910478.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]