SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026636|ref|YP_910481.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026636|ref|YP_910481.1|
Domain Number 1 Region: 151-468
Classification Level Classification E-value
Superfamily Poly A polymerase C-terminal region-like 1.44e-65
Family Poly A polymerase C-terminal region-like 0.00098
Further Details:      
 
Domain Number 2 Region: 2-149
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.27e-36
Family Poly A polymerase head domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026636|ref|YP_910481.1|
Sequence length 472
Comment RNA nucleotidyltransferase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MNFEVWPEAIELGRMFAAEGYELALVGGPVRDLLLHRKSHDLDFCTSARPEQFEHILRRF
GHDGFWDMGRKFGTLGAMRRREDGTEVKVEVTTYRSDTYDPDSRKPEVNYGDTLEGDLSR
RDFTVNAMALRVPELEFVDPFGGANDLAKGVLRTPVDPRQSFDDDPLRMMRAVRFVAQLG
FRIEPETAEALSDMVDRIEIVSAERVRDELVKLLLSDRPRAGIEALVDSGLADIVLPEIP
ALQLEIDEHHRHKDVFEHTMIVIERAVALETGSDGPVPAPDLTLRLAALLHDIGKPKTRR
FEAGGKVSFHRHDAVGAKMTRKRLKALHFDHHMVEDVSELVNLHLRFHGYVEEPWTDSAV
RRYVKDAGPLYERLNRLTRADTTTQNKRKAMMFSAAMDEMEQRVRDLKEKEDFDAIRPDL
NGDEIMQLLSIEPGPMVGKAYKHMLEYRLDNGPVERDVAVAELERWYKEQGE
Download sequence
Identical sequences A0A076JJA5 A1A3W6
gi|119026636|ref|YP_910481.1| WP_011743909.1.16084 WP_011743909.1.23347 WP_011743909.1.24652 WP_011743909.1.36503 WP_011743909.1.38945 WP_011743909.1.41253 WP_011743909.1.43097 WP_011743909.1.51786 WP_011743909.1.54320 WP_011743909.1.55335 WP_011743909.1.55963 WP_011743909.1.6218 WP_011743909.1.64668 WP_011743909.1.90122 WP_011743909.1.92700 367928.BAD_1618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]