SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026640|ref|YP_910485.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026640|ref|YP_910485.1|
Domain Number 1 Region: 7-219
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000841
Family Protein kinases, catalytic subunit 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119026640|ref|YP_910485.1|
Sequence length 675
Comment hypothetical protein BAD_1622 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MKPQLGDTISNRYVLVSPLREETGLQVWKASDHVLARDCQLFIVNNRKALQDVNATASML
AISHDAHFTQVLQLQHVGEVALVITQLDAGMSLSEYLTQSSKPLSFTAIRSILGEVVEAL
HVLQKDNLTHFSISTDTVRLTRNGIEIADAPVSIMLADTSRVQSVENQEQLAIRQVASLL
YSLLTRTPSTLSTNYHLDAISPNVPMEFRVICKRGLDLKEKDGFPTVPMATIAELEALLG
DYEPLVKLNGPDIALPSADSECSIVNVPLLQILEQDAIALPDTLAETGSIPEMTFEAPEP
HTDFSDSKEALAKGMAATGGAVKSLWNNSRELLSEEDLDGSSEDVDSPFSFPIRVSTPSP
QGDYHTDDSQLEKTGRIPVIGPDGRVIEPGEESARALKAEQEAIDAAYQNENGAPVAVPP
SFAPKASSSSPAEVANAKLFGKLTTKVVAIVVAFIVVAVALGFAIHGLTKKPDDGITNTN
SNNPWPEMNLDDVPFGNNGDSGNGSSSASDANNDSNDANSSDNGSSDSSKPKKTTKKSHS
AKKDVDKVVTSDKKVRKVPEPKMPENTTPYEIDNRQFLSNPDGQQGYGYYLHLSQPQKAY
RMVIKIRSSGGQGYIRVNAKSSPNQGEQVAQFEFDASGTTEIKFNKAVETQDILLWVPFD
SLPGNQLYIDSVQIF
Download sequence
Identical sequences A1A3X0
WP_011743913.1.36503 WP_011743913.1.64668 gi|119026640|ref|YP_910485.1| 367928.BAD_1622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]