SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026644|ref|YP_910489.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026644|ref|YP_910489.1|
Domain Number 1 Region: 37-231
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.27e-27
Family Glucose-inhibited division protein B (GidB) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119026644|ref|YP_910489.1|
Sequence length 249
Comment 16S rRNA methyltransferase GidB [Bifidobacterium adolescentis ATCC 15703]
Sequence
MRMVCMSDVNDELDGSPILEEVLGDALGKLKVFHVKLAAEGEPRGLIGPRDVGIIWERHI
LNSAAIVPFIREATAKRQFKTVADIGSGGGFPGIVAAACLPDHQFTLVEPMERRIEWLHE
CVDEMGLDNVSIVRSRANAVIEAVRGSNGGRKGRGEDAVDLDGNPIPVRHPFAVVTCRAV
APMTKLSGWTLPLLDKGGRLVALKGRSAQEEIVKATKEISKNGGIHPRVVEAEVGPGLEP
THVLMVDER
Download sequence
Identical sequences A1A3X4
367928.BAD_1626 gi|119026644|ref|YP_910489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]