SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026645|ref|YP_910490.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026645|ref|YP_910490.1|
Domain Number 1 Region: 118-160
Classification Level Classification E-value
Superfamily R3H domain 0.00000000000294
Family R3H domain 0.0036
Further Details:      
 
Weak hits

Sequence:  gi|119026645|ref|YP_910490.1|
Domain Number - Region: 41-79
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.00209
Family Prokaryotic type KH domain (KH-domain type II) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026645|ref|YP_910490.1|
Sequence length 175
Comment hypothetical protein BAD_1627 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MAQDAEKTIDQLNDEADIAADYLEGLLDIVDYEGDIEMGVRNNRPTVQIVADDDTDIKHL
IGRNGEVVDALQQLTRLAVQQKTGERSHLIVDVDGYLKRKRQRLHDLALDAIDEARETGE
PVDLKPMNSFERKIIHDVVREEGMKSRSHGEEPHRYVTVYVKASAADDADEIDEA
Download sequence
Identical sequences A0A0B5BJT4 A1A3X5 R5GRR7
389273 gi|119026645|ref|YP_910490.1| WP_011743917.1.23347 WP_011743917.1.24652 WP_011743917.1.31140 WP_011743917.1.31393 WP_011743917.1.36503 WP_011743917.1.55335 WP_011743917.1.6218 WP_011743917.1.64668 WP_011743917.1.68247 WP_011743917.1.90122 WP_011743917.1.92700 WP_011743917.1.95811 2004012158 367928.BAD_1627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]