SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025343|ref|YP_909188.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025343|ref|YP_909188.1|
Domain Number 1 Region: 3-83
Classification Level Classification E-value
Superfamily Ribosomal protein S19 1.83e-33
Family Ribosomal protein S19 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025343|ref|YP_909188.1|
Sequence length 92
Comment 30S ribosomal protein S19 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTRSIKKGPFVDAHLQKKVDEQNEKGTHNVIKTWSRRSMITPDFIGHTFAVHDGRKHVPV
FVTESMVGHKLGEFAPTKTFKGHVKDDKKARR
Download sequence
Identical sequences A0A072MUC9 A0A076JFC4 A0A087B7P1 A0A087BDM0 A0A087CWC7 A0A087DLV4 A0A0A7I5A3 A0A126ST79 A0A173X6R7 A0A1Q6EV80 A0A1V8PNY2 A0A1V8Q5E6 A0A2G5PW19 A0A2G5Q5Z8 A1A073 A7A426 B6XWV7 C0BQH6 C4FGQ8 D2Q8H4 E0Q8P1 S6CP78 W2VIW6 W4N747
gi|283455370|ref|YP_003359934.1| WP_003808025.1.100601 WP_003808025.1.100840 WP_003808025.1.10596 WP_003808025.1.10796 WP_003808025.1.11892 WP_003808025.1.12562 WP_003808025.1.14184 WP_003808025.1.14720 WP_003808025.1.14814 WP_003808025.1.16084 WP_003808025.1.21570 WP_003808025.1.23347 WP_003808025.1.2424 WP_003808025.1.24652 WP_003808025.1.25957 WP_003808025.1.26362 WP_003808025.1.26643 WP_003808025.1.28806 WP_003808025.1.31140 WP_003808025.1.31393 WP_003808025.1.3372 WP_003808025.1.36503 WP_003808025.1.38945 WP_003808025.1.39260 WP_003808025.1.39608 WP_003808025.1.40373 WP_003808025.1.41253 WP_003808025.1.42327 WP_003808025.1.43097 WP_003808025.1.44880 WP_003808025.1.45016 WP_003808025.1.4520 WP_003808025.1.46151 WP_003808025.1.47152 WP_003808025.1.4717 WP_003808025.1.50589 WP_003808025.1.51786 WP_003808025.1.53636 WP_003808025.1.54320 WP_003808025.1.55335 WP_003808025.1.55963 WP_003808025.1.5662 WP_003808025.1.57152 WP_003808025.1.6218 WP_003808025.1.64668 WP_003808025.1.64986 WP_003808025.1.68247 WP_003808025.1.7264 WP_003808025.1.74636 WP_003808025.1.76728 WP_003808025.1.77973 WP_003808025.1.80334 WP_003808025.1.81525 WP_003808025.1.82414 WP_003808025.1.85003 WP_003808025.1.86465 WP_003808025.1.8838 WP_003808025.1.90122 WP_003808025.1.91619 WP_003808025.1.92700 WP_003808025.1.93505 WP_003808025.1.93585 WP_003808025.1.95811 WP_003808025.1.97116 WP_003808025.1.97642 WP_003808025.1.98010 WP_003808025.1.99455 gi|119025343|ref|YP_909188.1| 367928.BAD_0325 401473.BDP_0434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]