SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025705|ref|YP_909550.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025705|ref|YP_909550.1|
Domain Number 1 Region: 18-380
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.02e-59
Family TK-like PP module 0.045
Further Details:      
 
Domain Number 2 Region: 409-609
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.16e-18
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.065
Further Details:      
 
Domain Number 3 Region: 636-769
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000549
Family Transketolase C-terminal domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025705|ref|YP_909550.1|
Sequence length 825
Comment putative phosphoketolase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTSPVIGTPWKKLNAPVSEEAIEGVDKYWRAANYLSIGQIYLRSNPLMKEPFTREDVKHR
LVGHWGTTPGLNFLIGHINRLIADHQQNTVIIMGPGHGGPAGTAQSYLDGTYTEYFPNIT
KDEAGLQKFFRQFSYPGGIPSHYAPETPGSIHEGGELGYALSHAYGAVMNNPSLFVPAIV
GDGEAETGPLATGWQSNKLINPRTDGIVLPILHLNGYKIANPTILSRISDEELHEFFHGM
GYEPYEFVAGFDNEDHLSIHRRFAELFETVFDEICDIKAAAQTDDMTRPFYPMIIFRTPK
GWTCPKFIDGKKTEGSWRSHQVPLASARDTEAHFEVLKNWLESYKPEELFDENGAVKPEV
TAFMPTGELRIGENPNANGGRIREELKLPKLEDYEVKEVAEYGHGWGQLEATRRLGVYTR
DIIKNNPDSFRIFGPDETASNRLQAAYDVTNKQWDAGYLSAQVDEHMAVTGQVTEQLSEH
QMEGFLEGYLLTGRHGIWSSYESFVHVIDSMLNQHAKWLEATVREIPWRKPISSMNLLVS
SHVWRQDHNGFSHQDPGVTSVLLNKCFNNDHVIGIYFPVDSNMLLAVAEKCYKSTNKINA
IIAGKQPAATWLTLDEARAELEKGAAEWKWASNVKSNDEAQIVLAATGDVPTQEIMAAAD
KLDAMGIKFKVVNVVDLVKLQSAKENNEALSDEEFAELFTEDKPVLFAYHSYARDVRGLI
YDRPNHDNFNVHGYEEQGSTTTPYDMVRVNNIDRYELQAEALRMIDADKYADKINELEAF
RQEAFQFAVDNGYDHPDYTDWVYSGVNTNKQGAISATAATAGDNE
Download sequence
Identical sequences A0A076JGJ9 A1A185
gi|119025705|ref|YP_909550.1| WP_011743105.1.36503 WP_011743105.1.54320 WP_011743105.1.55963 WP_011743105.1.64668 367928.BAD_0687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]