SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025870|ref|YP_909715.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025870|ref|YP_909715.1|
Domain Number 1 Region: 29-252
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 5.1e-31
Family Cation efflux protein transmembrane domain-like 0.004
Further Details:      
 
Weak hits

Sequence:  gi|119025870|ref|YP_909715.1|
Domain Number - Region: 254-331
Classification Level Classification E-value
Superfamily Cation efflux protein cytoplasmic domain-like 0.00445
Family Cation efflux protein cytoplasmic domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025870|ref|YP_909715.1|
Sequence length 341
Comment cation transporter [Bifidobacterium adolescentis ATCC 15703]
Sequence
MSESRDPAGDSTTTNNMGEVREAEHQGAAVKAALGANIGVAIAKLLAAFFTGSSAMLSES
VHSIADCSNEIVLMVGGRFSKRKTDGDHPFGLYRAKYLASFVVATLLFFVGGFFSTSEAV
KKLVAISADPALRDVNRMELLVAFIVVVISACLEGFGLHQSIKEANERMERTNTPRMGVF
RFWRRTKSAELASVIMEDTLALIGLAFAGLGIGLAIALDDEVFDALGGLMVGLVLIVGSL
LLAFKSGSLLIGEAVDSDTRGKIVEAVTTTPGVERLLNMQTVHMSEDDILLCVKVQTSKL
DRDYDVETVDKIEKAVRTALPWYNFEIYVEPDIYSAKHVHA
Download sequence
Identical sequences A1A1Q0
WP_011743217.1.36503 WP_011743217.1.64668 367928.BAD_0852 gi|119025870|ref|YP_909715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]