SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026182|ref|YP_910027.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026182|ref|YP_910027.1|
Domain Number 1 Region: 72-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.65e-20
Family RIO1-like kinases 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119026182|ref|YP_910027.1|
Sequence length 523
Comment hypothetical protein BAD_1164 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTERSRFMMAALASAAMPNATIAGTRDSEQVNATDKGYGIDHAVVQDAAGKLYDTFASNT
PKGRKRLAGRVRAAQTLMGNRELGGLGFDVDRVLAFSNGEQERSVTGDVSVMIATHHDGQ
ARPLTLLTLDDCASVGTALGAIHRLRPDFLQEAGYPVFSTGQIRAQLTAWIKRLRQAGHV
PQEITTSWSDVLETDGLWSFATCPVHGGLSDGDVLFSGSSITAITNWQDMQVNDPARDLA
WIFSKLDENHRNALLSAYGRMLGNRLDDLIMLRANLWLQMEQVGDFISALNQADSVKIMQ
FKAQVERLAHQLGMLTAKNHRPSETRQDEQKAGNRPPSTITVGTLLDESERRRQAAAQQN
NDADATGERHIDATDMDDDRTGDFDVTGSQPVRKTKQIVDDATEAFDVTAAEHIASAGMV
SGNADSDDTSEREESPVSTFVPEQSARERHESLPSSSTIVISTLQTADGSDDTNEEEIPQ
AHSEAATMLIPLLERDEATMQKAKAEVDRLQAEDATDEKPRVE
Download sequence
Identical sequences A1A2L2
367928.BAD_1164 gi|119026182|ref|YP_910027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]