SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026300|ref|YP_910145.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026300|ref|YP_910145.1|
Domain Number 1 Region: 22-251
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 7.51e-37
Family Type II restriction endonuclease catalytic domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119026300|ref|YP_910145.1|
Sequence length 300
Comment restriction endonuclease RKpn2kI [Bifidobacterium adolescentis ATCC 15703]
Sequence
MITADDYKETIKEMRKDHFPSPFDIAYNSFMELGFDKMGKSYFKEHASDFVGQMRTQCWK
DFQVCEKKFTVKALSSLIDPMSFKGMEAVDAIKKFVSDYPQHIYELTLSNTQSRRSRAGK
EFEAIIEMMLIGASIPTDSQGNVGKQFFAQHHLGKLVDFVTPGAIQYSIDKQRTVLISAK
TTLRERWQEVPEEVTRTGAPRMYLATLDSDITENTLNVLYESNITIVTTKENRSHYTNPR
VMTFEEMITEASNITEKWEGYSYTDKQRSVVEQFLRKQIEKHKNHPIVCDYYKARLAECL
Download sequence
Identical sequences A1A2Y0
gi|119026300|ref|YP_910145.1| 367928.BAD_1282 WP_011743604.1.36503 WP_011743604.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]