SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026318|ref|YP_910163.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026318|ref|YP_910163.1|
Domain Number 1 Region: 28-212
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.04e-54
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.00096
Further Details:      
 
Domain Number 2 Region: 201-266
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.00000111
Family Hydantoinase (dihydropyrimidinase) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119026318|ref|YP_910163.1|
Sequence length 278
Comment putative allantoinase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MAKTDYPTQSTSHIGRIRHRRNGAKPAKWATNAATKSPTVANTVEPASRPAECEANAVRK
IVRLVARTGCRTHILHVSSGLSVDVLRRAKAEGLPVSAETCPHYLTLDCDHIPDNATAFK
CCPPIRDLHEQDALWAGLADGTLDGVVTDHSPASADMKAGTLATAWGGVSSLQVGFRAVL
TGAMRRGLSLTDVVRWMSCNTARLVGLDDRGDITPVLRADLAIIRPYERFVVDATALESR
NPICACDGMTLNGVVTRTFVAGRDALSGVREGNLIVRP
Download sequence
Identical sequences A1A2Z8
gi|119026318|ref|YP_910163.1| WP_011743619.1.36503 WP_011743619.1.64668 367928.BAD_1300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]