SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119026384|ref|YP_910229.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026384|ref|YP_910229.1|
Domain Number 1 Region: 31-242
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.000000000313
Family Sir2 family of transcriptional regulators 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119026384|ref|YP_910229.1|
Sequence length 475
Comment hypothetical protein BAD_1366 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MSYAVDGDGIDGVVILMVASQLEWSIIKQLPRIDRNEELTILLGAGASVPSGLPSWKDLI
GNMLRQQGMTVSANMASLLCDAGDLLFLAEAVKQHCGNENEWKRCILAALYPEGASYNPY
PPSYFHQQTARLAFQHQESVHLATLNFDLLLEYAIARIAVDSGKQTFPPVEHLHGKVFPA
SDGSSATVEDVVLTHDDYNKAMRDGKNHAKHYLEQTVTEGHHLLIAGTSFSDPDMRFWLS
DVLQNSGDSRATVLIARESMPEVTLNQFMGMKKVLAAQWESIGFHPIFVNDYTDAATLIN
EIGYMGNSSYCPPATRTKRLWKKLTGTEFRSYQERFAEKLHEQASQCEALIGHCRINVTL
WIAHGSQLTRYATHDRIYLYKEQLRNEAVGFDSPYIAGRVLGTNQSSSQSFENGIWKQVM
AFPIQVQESKGFSILPMAVLSIGIGKKINSVDNKNLAKKMQGMVNEWSSELRKAL
Download sequence
Identical sequences A1A364
gi|119026384|ref|YP_910229.1| WP_011743664.1.36503 WP_011743664.1.64668 367928.BAD_1366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]