SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145597415|ref|YP_001161490.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145597415|ref|YP_001161490.1|
Domain Number 1 Region: 61-324
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.14e-69
Family L-arabinose binding protein-like 0.0000189
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.32e-16
Family GalR/LacI-like bacterial regulator 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145597415|ref|YP_001161490.1|
Sequence length 328
Comment LacI family transcriptional regulator [Yersinia pestis Pestoides F]
Sequence
MVTLEDVAVLAGVSRATVSRVVNGDTNVKALTREKVEQAVAVLGYTPHPAARALASSQSN
TLGLVTTSYRGGFFGALMDFVQTETESQGKQLLVTQGRDNADKEWLAIQRLYNLRCDGLI
LHVRFLSDERLRQLAAANRPFVLLDRLVPDLEARCVTFDHHHASQMATQVLIDAGHRDIA
CISGSSQRQSSVLRIQGFLDAMQLAGLEPVACLEGVYDLESGYLRADEILKQPRLPTAIY
CCNEEMAIGALLAINKHGLQVPQDISLICYDSGERAPFVCPALTSVHFPIVEMAQYATQL
LIDPLIPAVNFPPAIIMRDSVMPPKTAC
Download sequence
Identical sequences A0A0E1NVJ3 A0A0H2W080 A0A0H2YNU3 A0A0H3AZR5 A0A0M1VCH6 A0A0U1EVG1 A0A0U1QTT8 A0A208S9N6 Q664N3 Q7CFV7
WP_002208881.1.100083 WP_002208881.1.100246 WP_002208881.1.10066 WP_002208881.1.100921 WP_002208881.1.10105 WP_002208881.1.101305 WP_002208881.1.101382 WP_002208881.1.101928 WP_002208881.1.102012 WP_002208881.1.102067 WP_002208881.1.10736 WP_002208881.1.10935 WP_002208881.1.10955 WP_002208881.1.11693 WP_002208881.1.12167 WP_002208881.1.12463 WP_002208881.1.12736 WP_002208881.1.12857 WP_002208881.1.1388 WP_002208881.1.14063 WP_002208881.1.14169 WP_002208881.1.14804 WP_002208881.1.15321 WP_002208881.1.15555 WP_002208881.1.15605 WP_002208881.1.15689 WP_002208881.1.16243 WP_002208881.1.16333 WP_002208881.1.17135 WP_002208881.1.17141 WP_002208881.1.17608 WP_002208881.1.17873 WP_002208881.1.18208 WP_002208881.1.18640 WP_002208881.1.18826 WP_002208881.1.19329 WP_002208881.1.19425 WP_002208881.1.19739 WP_002208881.1.19763 WP_002208881.1.20035 WP_002208881.1.20380 WP_002208881.1.2064 WP_002208881.1.20932 WP_002208881.1.21486 WP_002208881.1.21784 WP_002208881.1.21879 WP_002208881.1.21934 WP_002208881.1.22530 WP_002208881.1.22542 WP_002208881.1.23157 WP_002208881.1.23271 WP_002208881.1.23687 WP_002208881.1.23811 WP_002208881.1.24002 WP_002208881.1.2451 WP_002208881.1.24517 WP_002208881.1.25181 WP_002208881.1.25394 WP_002208881.1.26383 WP_002208881.1.2640 WP_002208881.1.26776 WP_002208881.1.26960 WP_002208881.1.27124 WP_002208881.1.27251 WP_002208881.1.2726 WP_002208881.1.28647 WP_002208881.1.28922 WP_002208881.1.29157 WP_002208881.1.29186 WP_002208881.1.29355 WP_002208881.1.2947 WP_002208881.1.29622 WP_002208881.1.2964 WP_002208881.1.29685 WP_002208881.1.29814 WP_002208881.1.3092 WP_002208881.1.311 WP_002208881.1.31336 WP_002208881.1.31496 WP_002208881.1.31721 WP_002208881.1.31739 WP_002208881.1.31805 WP_002208881.1.32343 WP_002208881.1.32388 WP_002208881.1.32736 WP_002208881.1.33203 WP_002208881.1.33324 WP_002208881.1.33661 WP_002208881.1.33775 WP_002208881.1.33937 WP_002208881.1.34031 WP_002208881.1.34138 WP_002208881.1.35389 WP_002208881.1.35538 WP_002208881.1.36088 WP_002208881.1.37174 WP_002208881.1.37494 WP_002208881.1.37863 WP_002208881.1.38147 WP_002208881.1.38235 WP_002208881.1.38532 WP_002208881.1.38743 WP_002208881.1.38824 WP_002208881.1.38993 WP_002208881.1.39066 WP_002208881.1.39346 WP_002208881.1.3976 WP_002208881.1.39858 WP_002208881.1.40071 WP_002208881.1.40134 WP_002208881.1.40534 WP_002208881.1.40853 WP_002208881.1.41196 WP_002208881.1.41984 WP_002208881.1.4210 WP_002208881.1.42361 WP_002208881.1.42490 WP_002208881.1.44408 WP_002208881.1.44598 WP_002208881.1.44603 WP_002208881.1.44832 WP_002208881.1.45214 WP_002208881.1.46262 WP_002208881.1.46545 WP_002208881.1.46686 WP_002208881.1.46697 WP_002208881.1.46731 WP_002208881.1.4678 WP_002208881.1.46891 WP_002208881.1.47440 WP_002208881.1.47881 WP_002208881.1.48166 WP_002208881.1.48722 WP_002208881.1.4889 WP_002208881.1.49906 WP_002208881.1.4997 WP_002208881.1.50093 WP_002208881.1.50185 WP_002208881.1.50984 WP_002208881.1.51293 WP_002208881.1.51772 WP_002208881.1.51934 WP_002208881.1.52158 WP_002208881.1.52247 WP_002208881.1.52473 WP_002208881.1.52734 WP_002208881.1.52792 WP_002208881.1.52819 WP_002208881.1.52969 WP_002208881.1.53147 WP_002208881.1.53300 WP_002208881.1.53838 WP_002208881.1.53848 WP_002208881.1.53883 WP_002208881.1.53953 WP_002208881.1.54568 WP_002208881.1.54951 WP_002208881.1.55194 WP_002208881.1.55695 WP_002208881.1.5592 WP_002208881.1.56031 WP_002208881.1.56912 WP_002208881.1.56953 WP_002208881.1.57585 WP_002208881.1.57657 WP_002208881.1.58067 WP_002208881.1.58543 WP_002208881.1.58794 WP_002208881.1.59102 WP_002208881.1.59431 WP_002208881.1.5957 WP_002208881.1.5968 WP_002208881.1.59687 WP_002208881.1.59789 WP_002208881.1.59885 WP_002208881.1.60437 WP_002208881.1.60707 WP_002208881.1.60896 WP_002208881.1.62232 WP_002208881.1.62342 WP_002208881.1.6270 WP_002208881.1.6333 WP_002208881.1.63387 WP_002208881.1.63641 WP_002208881.1.64142 WP_002208881.1.64474 WP_002208881.1.64780 WP_002208881.1.64786 WP_002208881.1.64910 WP_002208881.1.653 WP_002208881.1.65400 WP_002208881.1.6570 WP_002208881.1.65706 WP_002208881.1.65718 WP_002208881.1.6581 WP_002208881.1.66118 WP_002208881.1.66546 WP_002208881.1.66616 WP_002208881.1.67404 WP_002208881.1.67850 WP_002208881.1.6791 WP_002208881.1.68361 WP_002208881.1.68371 WP_002208881.1.68753 WP_002208881.1.68855 WP_002208881.1.69316 WP_002208881.1.69951 WP_002208881.1.70117 WP_002208881.1.70171 WP_002208881.1.70319 WP_002208881.1.70417 WP_002208881.1.70726 WP_002208881.1.7083 WP_002208881.1.7169 WP_002208881.1.71744 WP_002208881.1.72280 WP_002208881.1.72440 WP_002208881.1.72486 WP_002208881.1.7402 WP_002208881.1.74131 WP_002208881.1.74310 WP_002208881.1.74577 WP_002208881.1.74738 WP_002208881.1.75169 WP_002208881.1.7518 WP_002208881.1.75208 WP_002208881.1.75337 WP_002208881.1.75407 WP_002208881.1.75636 WP_002208881.1.75821 WP_002208881.1.76555 WP_002208881.1.76670 WP_002208881.1.77295 WP_002208881.1.77387 WP_002208881.1.77569 WP_002208881.1.77691 WP_002208881.1.78004 WP_002208881.1.7841 WP_002208881.1.78556 WP_002208881.1.79515 WP_002208881.1.79550 WP_002208881.1.79609 WP_002208881.1.79825 WP_002208881.1.79981 WP_002208881.1.8009 WP_002208881.1.80331 WP_002208881.1.81848 WP_002208881.1.81877 WP_002208881.1.8210 WP_002208881.1.82133 WP_002208881.1.82151 WP_002208881.1.82270 WP_002208881.1.82436 WP_002208881.1.82619 WP_002208881.1.8303 WP_002208881.1.83039 WP_002208881.1.83265 WP_002208881.1.83630 WP_002208881.1.8420 WP_002208881.1.84703 WP_002208881.1.84720 WP_002208881.1.85269 WP_002208881.1.85270 WP_002208881.1.8559 WP_002208881.1.85802 WP_002208881.1.86034 WP_002208881.1.86059 WP_002208881.1.86413 WP_002208881.1.87107 WP_002208881.1.8728 WP_002208881.1.87418 WP_002208881.1.8762 WP_002208881.1.87853 WP_002208881.1.87988 WP_002208881.1.88362 WP_002208881.1.88472 WP_002208881.1.89359 WP_002208881.1.89542 WP_002208881.1.8964 WP_002208881.1.90176 WP_002208881.1.9051 WP_002208881.1.90624 WP_002208881.1.91373 WP_002208881.1.91844 WP_002208881.1.92030 WP_002208881.1.92331 WP_002208881.1.92604 WP_002208881.1.927 WP_002208881.1.9311 WP_002208881.1.9320 WP_002208881.1.93623 WP_002208881.1.93928 WP_002208881.1.93933 WP_002208881.1.94052 WP_002208881.1.94201 WP_002208881.1.94545 WP_002208881.1.94683 WP_002208881.1.95746 WP_002208881.1.95981 WP_002208881.1.97245 WP_002208881.1.97448 WP_002208881.1.97791 WP_002208881.1.97864 WP_002208881.1.97872 WP_002208881.1.97894 WP_002208881.1.99383 WP_002208881.1.9941 WP_002208881.1.99416 WP_002208881.1.99788 WP_002208881.1.99882 WP_002208881.1.99972 WP_002208881.1.99990 YP_002345251.1.25044 gi|218927376|ref|YP_002345251.1| gi|162419960|ref|YP_001608028.1| gi|294502254|ref|YP_003566316.1| gi|45440029|ref|NP_991568.1| gi|186897224|ref|YP_001874336.1| 187410.y3949 214092.YPO0165 229193.YP_0167 273123.YPTB3736 349746.YpAngola_A3711 349747.YpsIP31758_3952 360102.YPA_3304 377628.YPN_3899 386656.YPDSF_0092 502800.YPK_0240 502801.YPTS_3930 gi|22127819|ref|NP_671242.1| gi|384124621|ref|YP_005507235.1| gi|384120738|ref|YP_005503358.1| gi|153946844|ref|YP_001402900.1| gi|51598026|ref|YP_072217.1| gi|145597415|ref|YP_001161490.1| gi|108809295|ref|YP_653211.1| gi|170022501|ref|YP_001719006.1| gi|384412797|ref|YP_005622159.1| gi|108814059|ref|YP_649826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]