SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145597556|ref|YP_001161632.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145597556|ref|YP_001161632.1|
Domain Number 1 Region: 28-327
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.53e-65
Family L-arabinose binding protein-like 0.000066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145597556|ref|YP_001161632.1|
Sequence length 329
Comment periplasmic binding protein [Yersinia pestis Pestoides F]
Sequence
MKFNLALLNVCIVSACMLFTTQTLAAEKKHEIAVVAKVTGIPWFTRMEVGVNEAAKKLNV
NAYQVGPATPDPAQQVKVIEDLIAKNVDAIIVVPNDAKVLEPVLKKAQEKGIVVLTHESP
DQRIGQWDVETIDSEKYAQANMDELAKAMGNKGGYAIYVGSLTVPLHNAWADYAIKYQKE
KYPEMFEVTPRLPVAENIDKSYSTTLDLMKTYPQMKGIIGFGSLGPIGAGQAVAKKRAKD
QIAVVGIAMPAQAAPYLMRGDIKKALLWDPKDAGFAVVEIANQLLNGQKVTEDLTIDGLG
KADVDSKNGVIRFNKILEVTKDNAKTLGF
Download sequence
Identical sequences A0A0E1NMF3 A0A0H2YLN6 A0A0M1V9E2 A0A0U1EUZ4 A0A151CWJ5 Q665C2
gi|108813697|ref|YP_649464.1| gi|384416700|ref|YP_005626062.1| gi|186897084|ref|YP_001874196.1| gi|294505231|ref|YP_003569293.1| WP_002210043.1.52969 gi|384123697|ref|YP_005506317.1| gi|384127664|ref|YP_005510278.1| gi|108809637|ref|YP_653553.1| 273123.YPTB3596 360102.YPA_3646 377628.YPN_3537 386656.YPDSF_0240 502801.YPTS_3786 gi|51597887|ref|YP_072078.1| gi|145597556|ref|YP_001161632.1| gi|384138489|ref|YP_005521191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]