SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145597663|ref|YP_001161739.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145597663|ref|YP_001161739.1|
Domain Number 1 Region: 290-318,361-688
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.94e-79
Family L-arabinose binding protein-like 0.00000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145597663|ref|YP_001161739.1|
Sequence length 689
Comment hypothetical protein YPDSF_0349 [Yersinia pestis Pestoides F]
Sequence
MQKLLLDRVDSLFHPNYRFNIEHLEKNITGYSMLSSTFVRSKAGLVPVILAALILAACTG
DAPQTPPPVNIQDEASANSDYYLQQLQQSSDDNKADWQLLAIRALLREAKVPQAAEQLST
LPANLSDTQRQEQQLLAAELLIAQKNTPAAADILAKLEATQLSANQKVRYYQAQIAANQD
KATLPLIRAFIAQEPLLTDKAHQDNIDGTWQSLSQLTPQELNTMVINADENVLQGWLDLL
RVYQDNKQDPELLKAGIKDWQTRYPQNPAAKNLPTALTQISNFSQASTAKIALLLPLSGP
AQVFADAIQQGFTAAQNGSAVTASVPVTPNVTESSPTDTAAVVSDDTPATLPAPVPPPVV
TNAQVKIYDTNTQPLAALLAQAQQDGATLVVGPLLKPEVEQLSATPSTLNILALNQPEAS
NNSPNICYFALSPEDEARDAAHHLWEQQKRMPLLLVPRGALGERIAKAFADEWQKQGGQT
VLQQNFGSTTELKQSINSGAGIRLTGTPVSVSNVAAAPASVTIAGLTIPAPPIDAPVVST
SSSGNIDAVYIIATPSELTLIKPMIDMATSSRSKPALFASSRSYQAGAGPDYRLEMEGIQ
FSDIPLMAGSNPALLQQASAKYANDYSLVRLYAMGIDAWALANHFSEMRQIPGFQVKGVT
GDLTASSDCVITRKLPWLQYRQGMVVPLA
Download sequence
Identical sequences A0A0H2YDC6 A0A0H2YLS4 A0A0M1V938 Q8D1R7
gi|108813591|ref|YP_649358.1| gi|108809745|ref|YP_653661.1| gi|145597663|ref|YP_001161739.1| gi|22124038|ref|NP_667461.1| gi|384138600|ref|YP_005521302.1| gi|294505328|ref|YP_003569390.1| gi|384127567|ref|YP_005510181.1| gi|384123795|ref|YP_005506415.1| gi|45443533|ref|NP_995072.1| 187410.y0118 229193.YP_3802 360102.YPA_3754 377628.YPN_3431 386656.YPDSF_0349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]