SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145597708|ref|YP_001161784.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145597708|ref|YP_001161784.1|
Domain Number 1 Region: 63-327
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.65e-72
Family L-arabinose binding protein-like 0.0000431
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.22e-17
Family GalR/LacI-like bacterial regulator 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145597708|ref|YP_001161784.1|
Sequence length 328
Comment LacI-family regulatory protein [Yersinia pestis Pestoides F]
Sequence
MSVTIKDVAKRAKVSISTVSYAINGSPKITEETRLRVLKIAQEMNYTANNNAKMLKAKKS
GAIGLFFNSWFGPVYSELVRGIEERVHREHYDLVACSLYGGEQSTAHKYLRDRSVDGAII
LTSSFDDRFLQSVASDVLPIVVLDRELKSPHIYNVLIDNFGGAFKAVNALLAKGCRDIYF
FSGPEQSYDNQKRLDGFIAALGYHNIQLNRDFIIHSNFTEADAYLKMQALIAAGRVPSAI
FSANDEMAIGILRAAKEHNIRVPDDLKVVGFDNIYASSVLTPSLTTINHHKYEMGVISAN
TLLRAIKEETNIDAVTLLPTELIERETL
Download sequence
Identical sequences A0A0E1P2P0 A0A0M1V843 A0A208SCJ4 Q0WJ58 Q7CGE6
gi|294502692|ref|YP_003566754.1| gi|108809170|ref|YP_653086.1| gi|145597708|ref|YP_001161784.1| WP_002210384.1.100083 WP_002210384.1.100246 WP_002210384.1.100921 WP_002210384.1.100931 WP_002210384.1.10105 WP_002210384.1.101305 WP_002210384.1.101382 WP_002210384.1.101928 WP_002210384.1.102012 WP_002210384.1.102067 WP_002210384.1.10736 WP_002210384.1.10935 WP_002210384.1.10955 WP_002210384.1.11693 WP_002210384.1.12463 WP_002210384.1.12736 WP_002210384.1.12857 WP_002210384.1.1388 WP_002210384.1.14063 WP_002210384.1.14804 WP_002210384.1.15321 WP_002210384.1.15555 WP_002210384.1.15605 WP_002210384.1.15689 WP_002210384.1.16243 WP_002210384.1.16333 WP_002210384.1.17135 WP_002210384.1.17141 WP_002210384.1.17608 WP_002210384.1.17873 WP_002210384.1.17983 WP_002210384.1.18208 WP_002210384.1.18640 WP_002210384.1.18826 WP_002210384.1.19329 WP_002210384.1.19425 WP_002210384.1.19739 WP_002210384.1.19763 WP_002210384.1.20035 WP_002210384.1.2064 WP_002210384.1.21486 WP_002210384.1.21784 WP_002210384.1.21879 WP_002210384.1.21934 WP_002210384.1.22530 WP_002210384.1.22542 WP_002210384.1.22708 WP_002210384.1.23157 WP_002210384.1.23271 WP_002210384.1.23687 WP_002210384.1.23811 WP_002210384.1.2451 WP_002210384.1.25181 WP_002210384.1.25394 WP_002210384.1.2640 WP_002210384.1.26776 WP_002210384.1.26960 WP_002210384.1.27124 WP_002210384.1.27251 WP_002210384.1.2726 WP_002210384.1.28647 WP_002210384.1.29355 WP_002210384.1.2947 WP_002210384.1.29622 WP_002210384.1.2964 WP_002210384.1.29685 WP_002210384.1.29814 WP_002210384.1.3092 WP_002210384.1.30931 WP_002210384.1.311 WP_002210384.1.31336 WP_002210384.1.31496 WP_002210384.1.31739 WP_002210384.1.31805 WP_002210384.1.32343 WP_002210384.1.32388 WP_002210384.1.32446 WP_002210384.1.33203 WP_002210384.1.33661 WP_002210384.1.33937 WP_002210384.1.34031 WP_002210384.1.34138 WP_002210384.1.35389 WP_002210384.1.35538 WP_002210384.1.36088 WP_002210384.1.37174 WP_002210384.1.37494 WP_002210384.1.37863 WP_002210384.1.38147 WP_002210384.1.38235 WP_002210384.1.38743 WP_002210384.1.38824 WP_002210384.1.38993 WP_002210384.1.39066 WP_002210384.1.39346 WP_002210384.1.3976 WP_002210384.1.40071 WP_002210384.1.40134 WP_002210384.1.40534 WP_002210384.1.40853 WP_002210384.1.41196 WP_002210384.1.42490 WP_002210384.1.44408 WP_002210384.1.44598 WP_002210384.1.44603 WP_002210384.1.44832 WP_002210384.1.45198 WP_002210384.1.45214 WP_002210384.1.46262 WP_002210384.1.46545 WP_002210384.1.46686 WP_002210384.1.46731 WP_002210384.1.4678 WP_002210384.1.46891 WP_002210384.1.47387 WP_002210384.1.47440 WP_002210384.1.48722 WP_002210384.1.4889 WP_002210384.1.49906 WP_002210384.1.4997 WP_002210384.1.50010 WP_002210384.1.50093 WP_002210384.1.50106 WP_002210384.1.50984 WP_002210384.1.51284 WP_002210384.1.51293 WP_002210384.1.51588 WP_002210384.1.51772 WP_002210384.1.51934 WP_002210384.1.52158 WP_002210384.1.52247 WP_002210384.1.52734 WP_002210384.1.52819 WP_002210384.1.52969 WP_002210384.1.53838 WP_002210384.1.53953 WP_002210384.1.54951 WP_002210384.1.55194 WP_002210384.1.55695 WP_002210384.1.5592 WP_002210384.1.56031 WP_002210384.1.56912 WP_002210384.1.56953 WP_002210384.1.57585 WP_002210384.1.57657 WP_002210384.1.58067 WP_002210384.1.58794 WP_002210384.1.59102 WP_002210384.1.59431 WP_002210384.1.5957 WP_002210384.1.59635 WP_002210384.1.59687 WP_002210384.1.59789 WP_002210384.1.59885 WP_002210384.1.60437 WP_002210384.1.60707 WP_002210384.1.60896 WP_002210384.1.61689 WP_002210384.1.62232 WP_002210384.1.62342 WP_002210384.1.6270 WP_002210384.1.63387 WP_002210384.1.64142 WP_002210384.1.64780 WP_002210384.1.64786 WP_002210384.1.64910 WP_002210384.1.653 WP_002210384.1.65400 WP_002210384.1.65554 WP_002210384.1.6570 WP_002210384.1.65706 WP_002210384.1.65718 WP_002210384.1.6581 WP_002210384.1.66118 WP_002210384.1.66546 WP_002210384.1.66616 WP_002210384.1.67404 WP_002210384.1.67850 WP_002210384.1.68361 WP_002210384.1.68855 WP_002210384.1.69018 WP_002210384.1.69316 WP_002210384.1.69951 WP_002210384.1.70117 WP_002210384.1.70171 WP_002210384.1.70319 WP_002210384.1.70377 WP_002210384.1.70417 WP_002210384.1.7083 WP_002210384.1.7169 WP_002210384.1.71744 WP_002210384.1.72280 WP_002210384.1.72440 WP_002210384.1.72486 WP_002210384.1.7402 WP_002210384.1.74310 WP_002210384.1.74577 WP_002210384.1.74738 WP_002210384.1.75173 WP_002210384.1.7518 WP_002210384.1.75337 WP_002210384.1.75407 WP_002210384.1.75636 WP_002210384.1.75689 WP_002210384.1.75821 WP_002210384.1.76670 WP_002210384.1.77387 WP_002210384.1.77429 WP_002210384.1.77691 WP_002210384.1.78004 WP_002210384.1.7841 WP_002210384.1.78556 WP_002210384.1.79550 WP_002210384.1.79609 WP_002210384.1.79981 WP_002210384.1.8009 WP_002210384.1.80331 WP_002210384.1.81848 WP_002210384.1.81877 WP_002210384.1.8210 WP_002210384.1.82133 WP_002210384.1.82151 WP_002210384.1.82270 WP_002210384.1.82619 WP_002210384.1.8303 WP_002210384.1.83039 WP_002210384.1.83265 WP_002210384.1.8420 WP_002210384.1.84703 WP_002210384.1.84720 WP_002210384.1.85269 WP_002210384.1.85270 WP_002210384.1.8559 WP_002210384.1.85802 WP_002210384.1.86034 WP_002210384.1.87107 WP_002210384.1.8728 WP_002210384.1.87418 WP_002210384.1.8762 WP_002210384.1.87853 WP_002210384.1.87988 WP_002210384.1.88362 WP_002210384.1.88472 WP_002210384.1.89359 WP_002210384.1.8964 WP_002210384.1.90176 WP_002210384.1.9051 WP_002210384.1.90624 WP_002210384.1.91373 WP_002210384.1.91844 WP_002210384.1.92030 WP_002210384.1.92331 WP_002210384.1.92604 WP_002210384.1.927 WP_002210384.1.9311 WP_002210384.1.9320 WP_002210384.1.93623 WP_002210384.1.93928 WP_002210384.1.93933 WP_002210384.1.94201 WP_002210384.1.94545 WP_002210384.1.94683 WP_002210384.1.95746 WP_002210384.1.95981 WP_002210384.1.97245 WP_002210384.1.97375 WP_002210384.1.97448 WP_002210384.1.97791 WP_002210384.1.97864 WP_002210384.1.97872 WP_002210384.1.97894 WP_002210384.1.99109 WP_002210384.1.99383 WP_002210384.1.9941 WP_002210384.1.99416 WP_002210384.1.99788 WP_002210384.1.99990 YP_002345680.1.25044 gi|384121125|ref|YP_005503745.1| gi|384416324|ref|YP_005625686.1| gi|218927805|ref|YP_002345680.1| gi|45442694|ref|NP_994233.1| gi|384137401|ref|YP_005520103.1| 187410.y3567 214092.YPO0611 229193.YP_2929 360102.YPA_3179 386656.YPDSF_0396 gi|22127441|ref|NP_670864.1| gi|384125004|ref|YP_005507618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]