SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145597862|ref|YP_001161938.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145597862|ref|YP_001161938.1|
Domain Number 1 Region: 23-314
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.69e-61
Family L-arabinose binding protein-like 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145597862|ref|YP_001161938.1|
Sequence length 319
Comment sugar ABC transporter periplasmic binding protein [Yersinia pestis Pestoides F]
Sequence
MKKRLIGLLLAGVTISMSVSAAEPLKIGFANRTLNGAFFNGLTEYMKIHAKEKGYTLITT
DARGDLNKQIADVEDMLSQGINYLILNPQDPQAGLRITEIAKRAGVPTVILDSDIALEAP
VITRVQANNAKNNNLIGEYAVGQFGDKPMNCIFLSGNQGNLVGQARRDNFLLGVAEAQLR
KYNRTNVNFLSQGWGNWDQQGGLKAMEDIIVAQGDKINCVYSEMDDMALGAIRALKAANK
LDNVKVYAHDGYKKGLEAVKKGELQATASNNPDLLTSTVLEVIGQYQAGQTSFPDYVYIP
SILITKDNVDKYYKEDSIF
Download sequence
Identical sequences A0A0E1NU87 A0A0H2W988 A0A0H2YM72 A0A0M1V9H0 A0A208S3A0 Q7CGR0
gi|384137044|ref|YP_005519746.1| gi|162418317|ref|YP_001604787.1| gi|384125191|ref|YP_005507805.1| gi|384413456|ref|YP_005622818.1| gi|108806302|ref|YP_650218.1| gi|145597862|ref|YP_001161938.1| gi|294502879|ref|YP_003566941.1| gi|22127222|ref|NP_670645.1| gi|218928130|ref|YP_002346005.1| gi|384121318|ref|YP_005503938.1| gi|45443221|ref|NP_994760.1| WP_002210001.1.100083 WP_002210001.1.100246 WP_002210001.1.100921 WP_002210001.1.100931 WP_002210001.1.10105 WP_002210001.1.101305 WP_002210001.1.101382 WP_002210001.1.101928 WP_002210001.1.102012 WP_002210001.1.102067 WP_002210001.1.10736 WP_002210001.1.10935 WP_002210001.1.10955 WP_002210001.1.11693 WP_002210001.1.12463 WP_002210001.1.12736 WP_002210001.1.12857 WP_002210001.1.1388 WP_002210001.1.14063 WP_002210001.1.14804 WP_002210001.1.15321 WP_002210001.1.15555 WP_002210001.1.15605 WP_002210001.1.15689 WP_002210001.1.16243 WP_002210001.1.16333 WP_002210001.1.17135 WP_002210001.1.17141 WP_002210001.1.17608 WP_002210001.1.17873 WP_002210001.1.17983 WP_002210001.1.18208 WP_002210001.1.18640 WP_002210001.1.18826 WP_002210001.1.19329 WP_002210001.1.19425 WP_002210001.1.19739 WP_002210001.1.19763 WP_002210001.1.20035 WP_002210001.1.2064 WP_002210001.1.21486 WP_002210001.1.21784 WP_002210001.1.21879 WP_002210001.1.21934 WP_002210001.1.22530 WP_002210001.1.22542 WP_002210001.1.22708 WP_002210001.1.23157 WP_002210001.1.23271 WP_002210001.1.23687 WP_002210001.1.23811 WP_002210001.1.24002 WP_002210001.1.2451 WP_002210001.1.25181 WP_002210001.1.25394 WP_002210001.1.2640 WP_002210001.1.26776 WP_002210001.1.26960 WP_002210001.1.27124 WP_002210001.1.27251 WP_002210001.1.2726 WP_002210001.1.28647 WP_002210001.1.28922 WP_002210001.1.29157 WP_002210001.1.29355 WP_002210001.1.2947 WP_002210001.1.29622 WP_002210001.1.2964 WP_002210001.1.29685 WP_002210001.1.29814 WP_002210001.1.3092 WP_002210001.1.30931 WP_002210001.1.311 WP_002210001.1.31496 WP_002210001.1.31739 WP_002210001.1.31805 WP_002210001.1.32343 WP_002210001.1.32388 WP_002210001.1.32446 WP_002210001.1.33203 WP_002210001.1.33661 WP_002210001.1.33937 WP_002210001.1.34031 WP_002210001.1.34138 WP_002210001.1.35389 WP_002210001.1.35538 WP_002210001.1.36088 WP_002210001.1.37174 WP_002210001.1.37494 WP_002210001.1.37863 WP_002210001.1.38147 WP_002210001.1.38235 WP_002210001.1.38743 WP_002210001.1.38824 WP_002210001.1.38993 WP_002210001.1.39066 WP_002210001.1.39346 WP_002210001.1.3976 WP_002210001.1.40071 WP_002210001.1.40134 WP_002210001.1.40534 WP_002210001.1.40853 WP_002210001.1.41196 WP_002210001.1.4210 WP_002210001.1.42490 WP_002210001.1.44408 WP_002210001.1.44598 WP_002210001.1.44603 WP_002210001.1.44832 WP_002210001.1.45198 WP_002210001.1.45214 WP_002210001.1.46262 WP_002210001.1.46545 WP_002210001.1.46686 WP_002210001.1.46731 WP_002210001.1.4678 WP_002210001.1.46891 WP_002210001.1.47387 WP_002210001.1.47440 WP_002210001.1.48166 WP_002210001.1.48722 WP_002210001.1.4889 WP_002210001.1.49906 WP_002210001.1.4997 WP_002210001.1.50010 WP_002210001.1.50093 WP_002210001.1.50106 WP_002210001.1.50984 WP_002210001.1.51284 WP_002210001.1.51293 WP_002210001.1.51588 WP_002210001.1.51772 WP_002210001.1.51934 WP_002210001.1.52158 WP_002210001.1.52247 WP_002210001.1.52734 WP_002210001.1.52819 WP_002210001.1.52969 WP_002210001.1.53300 WP_002210001.1.53838 WP_002210001.1.53848 WP_002210001.1.53953 WP_002210001.1.54568 WP_002210001.1.54951 WP_002210001.1.55194 WP_002210001.1.55695 WP_002210001.1.5592 WP_002210001.1.56031 WP_002210001.1.56912 WP_002210001.1.56953 WP_002210001.1.57585 WP_002210001.1.57657 WP_002210001.1.58067 WP_002210001.1.58794 WP_002210001.1.59102 WP_002210001.1.59431 WP_002210001.1.5957 WP_002210001.1.59635 WP_002210001.1.59687 WP_002210001.1.59789 WP_002210001.1.59885 WP_002210001.1.60437 WP_002210001.1.60707 WP_002210001.1.60896 WP_002210001.1.61689 WP_002210001.1.62232 WP_002210001.1.62342 WP_002210001.1.6270 WP_002210001.1.63387 WP_002210001.1.64142 WP_002210001.1.64474 WP_002210001.1.64780 WP_002210001.1.64786 WP_002210001.1.64910 WP_002210001.1.653 WP_002210001.1.65400 WP_002210001.1.65554 WP_002210001.1.6570 WP_002210001.1.65706 WP_002210001.1.65718 WP_002210001.1.6581 WP_002210001.1.66118 WP_002210001.1.66546 WP_002210001.1.66616 WP_002210001.1.67404 WP_002210001.1.67850 WP_002210001.1.68361 WP_002210001.1.68753 WP_002210001.1.68855 WP_002210001.1.69018 WP_002210001.1.69316 WP_002210001.1.69951 WP_002210001.1.70117 WP_002210001.1.70171 WP_002210001.1.70319 WP_002210001.1.70377 WP_002210001.1.70417 WP_002210001.1.70726 WP_002210001.1.7083 WP_002210001.1.7169 WP_002210001.1.71744 WP_002210001.1.72280 WP_002210001.1.72440 WP_002210001.1.72486 WP_002210001.1.7402 WP_002210001.1.74131 WP_002210001.1.74577 WP_002210001.1.74738 WP_002210001.1.75173 WP_002210001.1.7518 WP_002210001.1.75337 WP_002210001.1.75407 WP_002210001.1.75636 WP_002210001.1.75689 WP_002210001.1.75821 WP_002210001.1.76670 WP_002210001.1.77387 WP_002210001.1.77429 WP_002210001.1.77691 WP_002210001.1.78004 WP_002210001.1.7841 WP_002210001.1.78556 WP_002210001.1.79515 WP_002210001.1.79550 WP_002210001.1.79609 WP_002210001.1.79981 WP_002210001.1.8009 WP_002210001.1.80331 WP_002210001.1.81848 WP_002210001.1.81877 WP_002210001.1.8210 WP_002210001.1.82133 WP_002210001.1.82151 WP_002210001.1.82270 WP_002210001.1.82619 WP_002210001.1.8303 WP_002210001.1.83039 WP_002210001.1.83265 WP_002210001.1.8420 WP_002210001.1.84703 WP_002210001.1.84720 WP_002210001.1.85269 WP_002210001.1.85270 WP_002210001.1.8559 WP_002210001.1.85802 WP_002210001.1.86034 WP_002210001.1.86413 WP_002210001.1.87107 WP_002210001.1.8728 WP_002210001.1.87418 WP_002210001.1.8762 WP_002210001.1.87853 WP_002210001.1.87988 WP_002210001.1.88362 WP_002210001.1.88472 WP_002210001.1.89359 WP_002210001.1.8964 WP_002210001.1.90176 WP_002210001.1.9051 WP_002210001.1.90624 WP_002210001.1.91373 WP_002210001.1.91844 WP_002210001.1.92030 WP_002210001.1.92331 WP_002210001.1.92604 WP_002210001.1.927 WP_002210001.1.9311 WP_002210001.1.9320 WP_002210001.1.93623 WP_002210001.1.93928 WP_002210001.1.93933 WP_002210001.1.94052 WP_002210001.1.94201 WP_002210001.1.94545 WP_002210001.1.94683 WP_002210001.1.95746 WP_002210001.1.95981 WP_002210001.1.97245 WP_002210001.1.97375 WP_002210001.1.97448 WP_002210001.1.97791 WP_002210001.1.97864 WP_002210001.1.97872 WP_002210001.1.97894 WP_002210001.1.99109 WP_002210001.1.99383 WP_002210001.1.9941 WP_002210001.1.99416 WP_002210001.1.99788 WP_002210001.1.99990 YP_002346005.1.25044 gi|108813317|ref|YP_649084.1| 187410.y3346 214092.YPO0959 229193.YP_3482 349746.YpAngola_A0158 360102.YPA_0305 377628.YPN_3157 386656.YPDSF_0555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]