SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145597958|ref|YP_001162034.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145597958|ref|YP_001162034.1|
Domain Number 1 Region: 27-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.78e-65
Family L-arabinose binding protein-like 0.0000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145597958|ref|YP_001162034.1|
Sequence length 333
Comment sugar-binding periplasmic protein [Yersinia pestis Pestoides F]
Sequence
MKKTMLQTLLAATLILSFAASVQAAPVKIAILMYGMKAEFVQLMEKSAKEHPAVTQGLTT
LTLFDGRYDPLVQNNQAETAIRTRYDAIIIVPIDFEANVDVVTMANKANIPVIVANARLN
TDKATSGIFSDDVQGGYLEAKAVLDKMQCQGNVVVIEGPIGQSAQIQRGQGNDKAIAECG
PGKINVLERKTANWSRAEAMPLMENWLQKHRGKINGVIGQNDEMALGAIEAIKSAGLNVQ
DFAIAGIDGVSDAIRAVKQGEMMSILQDGQAQIQGAIDIAMRSVQGERYQPMSTIWQQYQ
GKMDWQQGTAKMYEVPWTEVTPQNADELLKMRQ
Download sequence
Identical sequences A0A0E1NQ30 A0A0E8XGW3 A0A0H2YK53 A0A0H3B0C8 A0A0M1VAE2 A0A0U1EPT4 A0A0U1QUR8 A0A208S4S4 A0A2A7VIZ2 Q0WIH7 Q666Y9
gi|294502963|ref|YP_003567025.1| gi|186896527|ref|YP_001873639.1| gi|384121402|ref|YP_005504022.1| gi|153947249|ref|YP_001399893.1| 214092.YPO0860 273123.YPTB3105 349746.YpAngola_A3878 349747.YpsIP31758_0909 360102.YPA_0410 377628.YPN_3062 386656.YPDSF_0652 502800.YPK_0964 502801.YPTS_3227 WP_002209906.1.100083 WP_002209906.1.100246 WP_002209906.1.100593 WP_002209906.1.10066 WP_002209906.1.100921 WP_002209906.1.100931 WP_002209906.1.10105 WP_002209906.1.101305 WP_002209906.1.101382 WP_002209906.1.101928 WP_002209906.1.102012 WP_002209906.1.102067 WP_002209906.1.10736 WP_002209906.1.10935 WP_002209906.1.10955 WP_002209906.1.11693 WP_002209906.1.12167 WP_002209906.1.12463 WP_002209906.1.12736 WP_002209906.1.12857 WP_002209906.1.1388 WP_002209906.1.14063 WP_002209906.1.14169 WP_002209906.1.14804 WP_002209906.1.15321 WP_002209906.1.15555 WP_002209906.1.15605 WP_002209906.1.15689 WP_002209906.1.16243 WP_002209906.1.16333 WP_002209906.1.17135 WP_002209906.1.17141 WP_002209906.1.17608 WP_002209906.1.17873 WP_002209906.1.17983 WP_002209906.1.18208 WP_002209906.1.18640 WP_002209906.1.18826 WP_002209906.1.19329 WP_002209906.1.19739 WP_002209906.1.19763 WP_002209906.1.20035 WP_002209906.1.20380 WP_002209906.1.20547 WP_002209906.1.2064 WP_002209906.1.20932 WP_002209906.1.21486 WP_002209906.1.21784 WP_002209906.1.21879 WP_002209906.1.21934 WP_002209906.1.22530 WP_002209906.1.22542 WP_002209906.1.22708 WP_002209906.1.23157 WP_002209906.1.23271 WP_002209906.1.23687 WP_002209906.1.23811 WP_002209906.1.24002 WP_002209906.1.2451 WP_002209906.1.24517 WP_002209906.1.25181 WP_002209906.1.25394 WP_002209906.1.26383 WP_002209906.1.2640 WP_002209906.1.26509 WP_002209906.1.26776 WP_002209906.1.26960 WP_002209906.1.27124 WP_002209906.1.27251 WP_002209906.1.2726 WP_002209906.1.28647 WP_002209906.1.28922 WP_002209906.1.29157 WP_002209906.1.29186 WP_002209906.1.29355 WP_002209906.1.2947 WP_002209906.1.29622 WP_002209906.1.2964 WP_002209906.1.29685 WP_002209906.1.30931 WP_002209906.1.311 WP_002209906.1.31336 WP_002209906.1.31496 WP_002209906.1.31721 WP_002209906.1.31739 WP_002209906.1.31805 WP_002209906.1.32343 WP_002209906.1.32388 WP_002209906.1.32446 WP_002209906.1.32736 WP_002209906.1.33203 WP_002209906.1.33324 WP_002209906.1.33661 WP_002209906.1.33775 WP_002209906.1.33937 WP_002209906.1.34031 WP_002209906.1.34138 WP_002209906.1.35389 WP_002209906.1.35538 WP_002209906.1.36088 WP_002209906.1.37174 WP_002209906.1.37494 WP_002209906.1.37863 WP_002209906.1.38147 WP_002209906.1.38235 WP_002209906.1.38532 WP_002209906.1.38743 WP_002209906.1.39066 WP_002209906.1.39346 WP_002209906.1.3976 WP_002209906.1.39858 WP_002209906.1.40071 WP_002209906.1.40134 WP_002209906.1.40534 WP_002209906.1.40853 WP_002209906.1.41196 WP_002209906.1.41984 WP_002209906.1.4210 WP_002209906.1.42361 WP_002209906.1.42490 WP_002209906.1.42976 WP_002209906.1.44408 WP_002209906.1.44598 WP_002209906.1.44603 WP_002209906.1.44832 WP_002209906.1.45198 WP_002209906.1.45214 WP_002209906.1.46262 WP_002209906.1.46545 WP_002209906.1.46686 WP_002209906.1.46697 WP_002209906.1.46731 WP_002209906.1.4678 WP_002209906.1.46891 WP_002209906.1.47387 WP_002209906.1.47440 WP_002209906.1.47769 WP_002209906.1.47881 WP_002209906.1.48166 WP_002209906.1.48722 WP_002209906.1.4889 WP_002209906.1.49315 WP_002209906.1.49906 WP_002209906.1.4997 WP_002209906.1.50010 WP_002209906.1.50093 WP_002209906.1.50106 WP_002209906.1.50185 WP_002209906.1.50984 WP_002209906.1.51284 WP_002209906.1.51293 WP_002209906.1.51588 WP_002209906.1.51772 WP_002209906.1.51934 WP_002209906.1.52158 WP_002209906.1.52247 WP_002209906.1.52473 WP_002209906.1.52734 WP_002209906.1.52792 WP_002209906.1.52819 WP_002209906.1.52969 WP_002209906.1.53147 WP_002209906.1.53300 WP_002209906.1.53838 WP_002209906.1.53883 WP_002209906.1.53953 WP_002209906.1.54568 WP_002209906.1.54951 WP_002209906.1.55194 WP_002209906.1.55695 WP_002209906.1.5592 WP_002209906.1.56031 WP_002209906.1.56912 WP_002209906.1.56953 WP_002209906.1.57585 WP_002209906.1.57657 WP_002209906.1.58067 WP_002209906.1.58543 WP_002209906.1.58794 WP_002209906.1.59102 WP_002209906.1.59431 WP_002209906.1.5957 WP_002209906.1.59635 WP_002209906.1.5968 WP_002209906.1.59687 WP_002209906.1.59789 WP_002209906.1.59885 WP_002209906.1.60437 WP_002209906.1.60707 WP_002209906.1.60896 WP_002209906.1.61689 WP_002209906.1.62232 WP_002209906.1.62342 WP_002209906.1.6333 WP_002209906.1.63387 WP_002209906.1.63517 WP_002209906.1.63641 WP_002209906.1.64142 WP_002209906.1.64474 WP_002209906.1.64780 WP_002209906.1.64786 WP_002209906.1.64910 WP_002209906.1.653 WP_002209906.1.65400 WP_002209906.1.65554 WP_002209906.1.6570 WP_002209906.1.65706 WP_002209906.1.65718 WP_002209906.1.6581 WP_002209906.1.66118 WP_002209906.1.66546 WP_002209906.1.66616 WP_002209906.1.67404 WP_002209906.1.67850 WP_002209906.1.6791 WP_002209906.1.68361 WP_002209906.1.68371 WP_002209906.1.68753 WP_002209906.1.68855 WP_002209906.1.69018 WP_002209906.1.69316 WP_002209906.1.69951 WP_002209906.1.70117 WP_002209906.1.70171 WP_002209906.1.70319 WP_002209906.1.70377 WP_002209906.1.70417 WP_002209906.1.70726 WP_002209906.1.7083 WP_002209906.1.7169 WP_002209906.1.71744 WP_002209906.1.72280 WP_002209906.1.72440 WP_002209906.1.72486 WP_002209906.1.7402 WP_002209906.1.74131 WP_002209906.1.74310 WP_002209906.1.74738 WP_002209906.1.75169 WP_002209906.1.75173 WP_002209906.1.7518 WP_002209906.1.75208 WP_002209906.1.75337 WP_002209906.1.75407 WP_002209906.1.75636 WP_002209906.1.75689 WP_002209906.1.75821 WP_002209906.1.76555 WP_002209906.1.76670 WP_002209906.1.77295 WP_002209906.1.77387 WP_002209906.1.77429 WP_002209906.1.77569 WP_002209906.1.77691 WP_002209906.1.7841 WP_002209906.1.78556 WP_002209906.1.79515 WP_002209906.1.79550 WP_002209906.1.79609 WP_002209906.1.79825 WP_002209906.1.79981 WP_002209906.1.8009 WP_002209906.1.81848 WP_002209906.1.81877 WP_002209906.1.8210 WP_002209906.1.82151 WP_002209906.1.82270 WP_002209906.1.82436 WP_002209906.1.82619 WP_002209906.1.8303 WP_002209906.1.83039 WP_002209906.1.83265 WP_002209906.1.83630 WP_002209906.1.8420 WP_002209906.1.84703 WP_002209906.1.84720 WP_002209906.1.85269 WP_002209906.1.85270 WP_002209906.1.8559 WP_002209906.1.85802 WP_002209906.1.86034 WP_002209906.1.86059 WP_002209906.1.86413 WP_002209906.1.87107 WP_002209906.1.8728 WP_002209906.1.87418 WP_002209906.1.8762 WP_002209906.1.87853 WP_002209906.1.87988 WP_002209906.1.88362 WP_002209906.1.88472 WP_002209906.1.89359 WP_002209906.1.89542 WP_002209906.1.8964 WP_002209906.1.90176 WP_002209906.1.9051 WP_002209906.1.90624 WP_002209906.1.91373 WP_002209906.1.91844 WP_002209906.1.92030 WP_002209906.1.92331 WP_002209906.1.92604 WP_002209906.1.927 WP_002209906.1.9311 WP_002209906.1.9320 WP_002209906.1.93928 WP_002209906.1.93933 WP_002209906.1.94052 WP_002209906.1.94201 WP_002209906.1.94545 WP_002209906.1.94683 WP_002209906.1.95746 WP_002209906.1.95981 WP_002209906.1.97245 WP_002209906.1.97375 WP_002209906.1.97448 WP_002209906.1.97791 WP_002209906.1.97864 WP_002209906.1.97872 WP_002209906.1.97894 WP_002209906.1.99109 WP_002209906.1.99383 WP_002209906.1.9941 WP_002209906.1.99416 WP_002209906.1.99788 WP_002209906.1.99882 WP_002209906.1.99972 WP_002209906.1.99990 YP_002345911.1.25044 gi|108813222|ref|YP_648989.1| gi|51597418|ref|YP_071609.1| gi|384125273|ref|YP_005507887.1| gi|162418259|ref|YP_001608180.1| gi|384137150|ref|YP_005519852.1| IDP02276 gi|170023213|ref|YP_001719718.1| gi|108806407|ref|YP_650323.1| gi|145597958|ref|YP_001162034.1| gi|218928036|ref|YP_002345911.1| gi|384413562|ref|YP_005622924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]