SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145597968|ref|YP_001162044.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145597968|ref|YP_001162044.1|
Domain Number 1 Region: 62-325
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.6e-51
Family L-arabinose binding protein-like 0.00000313
Further Details:      
 
Domain Number 2 Region: 5-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.66e-17
Family GalR/LacI-like bacterial regulator 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145597968|ref|YP_001162044.1|
Sequence length 357
Comment lac repressor [Yersinia pestis Pestoides F]
Sequence
MKSKSTTLEDVARHAGVSYQTVSRVLNKSAKVSEATRRKVEQSIELLRYVPNRLAQQLVG
KQSMTMGLVTTSLALHAPSQVAAAIKRYAHIEGYQVLISMIDESVNQSIQHSINDLKSQW
VGKVIINVPLETAVAEKIAADNDDVTCLFLDVDPYSSVFNVSFNPADGTRASVKYLYELG
HREIALLAGPKQSVSANLRLKSWLETLADYGLSPVSVIHGNWDAQSGYSGALQMLRETPQ
FSAVLVANDQMALGVLSAFHQNQLAVPGEKSVIGYDDTYESSFFYPALTTVSLDLDLQGK
EAVRRMLSASDNESMRSSSILPAKLVVRNSTGPQAKEHRDLQKIAEELRLIAQRLAS
Download sequence
Identical sequences A0A0E1NVV3 A0A0H2YK45 A0A0H3B2D7 A0A0M1V9N1 A0A0T9JU09 A0A0U1EPS6 A0A208S4U0 Q0WII8 Q666Z9
WP_002209894.1.100083 WP_002209894.1.100246 WP_002209894.1.100593 WP_002209894.1.10066 WP_002209894.1.100921 WP_002209894.1.100931 WP_002209894.1.10105 WP_002209894.1.101305 WP_002209894.1.101382 WP_002209894.1.101928 WP_002209894.1.102012 WP_002209894.1.102067 WP_002209894.1.10736 WP_002209894.1.10935 WP_002209894.1.10955 WP_002209894.1.11693 WP_002209894.1.12463 WP_002209894.1.12736 WP_002209894.1.12857 WP_002209894.1.1388 WP_002209894.1.14063 WP_002209894.1.14804 WP_002209894.1.15321 WP_002209894.1.15555 WP_002209894.1.15605 WP_002209894.1.15689 WP_002209894.1.16243 WP_002209894.1.16333 WP_002209894.1.17135 WP_002209894.1.17141 WP_002209894.1.17608 WP_002209894.1.17873 WP_002209894.1.17983 WP_002209894.1.18208 WP_002209894.1.18640 WP_002209894.1.18826 WP_002209894.1.19329 WP_002209894.1.19425 WP_002209894.1.19739 WP_002209894.1.19763 WP_002209894.1.20035 WP_002209894.1.20380 WP_002209894.1.20547 WP_002209894.1.2064 WP_002209894.1.20932 WP_002209894.1.21486 WP_002209894.1.21784 WP_002209894.1.21879 WP_002209894.1.21934 WP_002209894.1.22530 WP_002209894.1.22542 WP_002209894.1.22708 WP_002209894.1.23157 WP_002209894.1.23271 WP_002209894.1.23687 WP_002209894.1.23811 WP_002209894.1.24002 WP_002209894.1.2451 WP_002209894.1.24517 WP_002209894.1.25181 WP_002209894.1.25394 WP_002209894.1.26383 WP_002209894.1.2640 WP_002209894.1.26509 WP_002209894.1.26776 WP_002209894.1.26960 WP_002209894.1.27124 WP_002209894.1.27251 WP_002209894.1.2726 WP_002209894.1.28647 WP_002209894.1.28922 WP_002209894.1.29157 WP_002209894.1.29186 WP_002209894.1.29355 WP_002209894.1.2947 WP_002209894.1.29622 WP_002209894.1.2964 WP_002209894.1.29685 WP_002209894.1.29814 WP_002209894.1.3092 WP_002209894.1.30931 WP_002209894.1.311 WP_002209894.1.31336 WP_002209894.1.31721 WP_002209894.1.31739 WP_002209894.1.31805 WP_002209894.1.32343 WP_002209894.1.32388 WP_002209894.1.32446 WP_002209894.1.32736 WP_002209894.1.33203 WP_002209894.1.33324 WP_002209894.1.33661 WP_002209894.1.33775 WP_002209894.1.33937 WP_002209894.1.34031 WP_002209894.1.34138 WP_002209894.1.35389 WP_002209894.1.35538 WP_002209894.1.36088 WP_002209894.1.37174 WP_002209894.1.37494 WP_002209894.1.37863 WP_002209894.1.38147 WP_002209894.1.38235 WP_002209894.1.38532 WP_002209894.1.38743 WP_002209894.1.38824 WP_002209894.1.38993 WP_002209894.1.39066 WP_002209894.1.39346 WP_002209894.1.3976 WP_002209894.1.39858 WP_002209894.1.40134 WP_002209894.1.40534 WP_002209894.1.40853 WP_002209894.1.41196 WP_002209894.1.41984 WP_002209894.1.4210 WP_002209894.1.42361 WP_002209894.1.42490 WP_002209894.1.42976 WP_002209894.1.44408 WP_002209894.1.44598 WP_002209894.1.44603 WP_002209894.1.44832 WP_002209894.1.45198 WP_002209894.1.45214 WP_002209894.1.46262 WP_002209894.1.46545 WP_002209894.1.46686 WP_002209894.1.46697 WP_002209894.1.46731 WP_002209894.1.4678 WP_002209894.1.46891 WP_002209894.1.47387 WP_002209894.1.47440 WP_002209894.1.47881 WP_002209894.1.48166 WP_002209894.1.48722 WP_002209894.1.4889 WP_002209894.1.49315 WP_002209894.1.49906 WP_002209894.1.4997 WP_002209894.1.50010 WP_002209894.1.50093 WP_002209894.1.50106 WP_002209894.1.50185 WP_002209894.1.50984 WP_002209894.1.51284 WP_002209894.1.51293 WP_002209894.1.51588 WP_002209894.1.51772 WP_002209894.1.51934 WP_002209894.1.52158 WP_002209894.1.52247 WP_002209894.1.52473 WP_002209894.1.52734 WP_002209894.1.52792 WP_002209894.1.52819 WP_002209894.1.52969 WP_002209894.1.53147 WP_002209894.1.53300 WP_002209894.1.53838 WP_002209894.1.53848 WP_002209894.1.53883 WP_002209894.1.53953 WP_002209894.1.54568 WP_002209894.1.54951 WP_002209894.1.55194 WP_002209894.1.55695 WP_002209894.1.5592 WP_002209894.1.56031 WP_002209894.1.56912 WP_002209894.1.56953 WP_002209894.1.57585 WP_002209894.1.57657 WP_002209894.1.58067 WP_002209894.1.58794 WP_002209894.1.59102 WP_002209894.1.59431 WP_002209894.1.5957 WP_002209894.1.59635 WP_002209894.1.5968 WP_002209894.1.59687 WP_002209894.1.59789 WP_002209894.1.59885 WP_002209894.1.60707 WP_002209894.1.60896 WP_002209894.1.61689 WP_002209894.1.62232 WP_002209894.1.62342 WP_002209894.1.6270 WP_002209894.1.6333 WP_002209894.1.63387 WP_002209894.1.63641 WP_002209894.1.64142 WP_002209894.1.64474 WP_002209894.1.64780 WP_002209894.1.64786 WP_002209894.1.64910 WP_002209894.1.653 WP_002209894.1.65400 WP_002209894.1.65554 WP_002209894.1.6570 WP_002209894.1.65706 WP_002209894.1.65718 WP_002209894.1.6581 WP_002209894.1.66118 WP_002209894.1.66546 WP_002209894.1.66616 WP_002209894.1.67404 WP_002209894.1.67850 WP_002209894.1.6791 WP_002209894.1.68361 WP_002209894.1.68371 WP_002209894.1.68753 WP_002209894.1.68855 WP_002209894.1.69018 WP_002209894.1.69316 WP_002209894.1.69951 WP_002209894.1.70117 WP_002209894.1.70171 WP_002209894.1.70319 WP_002209894.1.70377 WP_002209894.1.70417 WP_002209894.1.70726 WP_002209894.1.7083 WP_002209894.1.7169 WP_002209894.1.71744 WP_002209894.1.72280 WP_002209894.1.72440 WP_002209894.1.72486 WP_002209894.1.7402 WP_002209894.1.74131 WP_002209894.1.74310 WP_002209894.1.74577 WP_002209894.1.74738 WP_002209894.1.75169 WP_002209894.1.75173 WP_002209894.1.7518 WP_002209894.1.75208 WP_002209894.1.75337 WP_002209894.1.75407 WP_002209894.1.75636 WP_002209894.1.75689 WP_002209894.1.75821 WP_002209894.1.76555 WP_002209894.1.76670 WP_002209894.1.77295 WP_002209894.1.77387 WP_002209894.1.77429 WP_002209894.1.77569 WP_002209894.1.77691 WP_002209894.1.78004 WP_002209894.1.7841 WP_002209894.1.78556 WP_002209894.1.7939 WP_002209894.1.79515 WP_002209894.1.79550 WP_002209894.1.79609 WP_002209894.1.79825 WP_002209894.1.79981 WP_002209894.1.8009 WP_002209894.1.80331 WP_002209894.1.81848 WP_002209894.1.81877 WP_002209894.1.8210 WP_002209894.1.82133 WP_002209894.1.82151 WP_002209894.1.82270 WP_002209894.1.82436 WP_002209894.1.82619 WP_002209894.1.8303 WP_002209894.1.83039 WP_002209894.1.83265 WP_002209894.1.83630 WP_002209894.1.8420 WP_002209894.1.84703 WP_002209894.1.84720 WP_002209894.1.85269 WP_002209894.1.85270 WP_002209894.1.8559 WP_002209894.1.85802 WP_002209894.1.86034 WP_002209894.1.86059 WP_002209894.1.86413 WP_002209894.1.87107 WP_002209894.1.8728 WP_002209894.1.87418 WP_002209894.1.8762 WP_002209894.1.87853 WP_002209894.1.87988 WP_002209894.1.88362 WP_002209894.1.88472 WP_002209894.1.89359 WP_002209894.1.89542 WP_002209894.1.8964 WP_002209894.1.90176 WP_002209894.1.9051 WP_002209894.1.90624 WP_002209894.1.91263 WP_002209894.1.91373 WP_002209894.1.91844 WP_002209894.1.92030 WP_002209894.1.92331 WP_002209894.1.92604 WP_002209894.1.927 WP_002209894.1.9311 WP_002209894.1.9320 WP_002209894.1.93623 WP_002209894.1.93928 WP_002209894.1.93933 WP_002209894.1.94052 WP_002209894.1.94201 WP_002209894.1.94545 WP_002209894.1.94683 WP_002209894.1.95746 WP_002209894.1.95981 WP_002209894.1.97245 WP_002209894.1.97375 WP_002209894.1.97448 WP_002209894.1.97791 WP_002209894.1.97864 WP_002209894.1.97872 WP_002209894.1.97894 WP_002209894.1.99109 WP_002209894.1.99383 WP_002209894.1.9941 WP_002209894.1.99416 WP_002209894.1.99788 WP_002209894.1.99882 WP_002209894.1.99972 WP_002209894.1.99990 YP_002345900.1.25044 gi|384413573|ref|YP_005622935.1| gi|51597408|ref|YP_071599.1| gi|384137161|ref|YP_005519863.1| gi|108813211|ref|YP_648978.1| 187410.y3234 214092.YPO0849 229193.YP_3546 273123.YPTB3094 349746.YpAngola_A3358 360102.YPA_0421 377628.YPN_3051 386656.YPDSF_0665 502800.YPK_0976 502801.YPTS_3216 gi|384121413|ref|YP_005504033.1| gi|186896516|ref|YP_001873628.1| gi|161511308|ref|NP_994822.2| gi|161484764|ref|NP_670533.2| gi|218928025|ref|YP_002345900.1| gi|294502974|ref|YP_003567036.1| gi|108806418|ref|YP_650334.1| gi|162418372|ref|YP_001607701.1| gi|170023225|ref|YP_001719730.1| gi|145597968|ref|YP_001162044.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]