SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145597971|ref|YP_001162047.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145597971|ref|YP_001162047.1|
Domain Number 1 Region: 75-340
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.07e-42
Family L-arabinose binding protein-like 0.0002
Further Details:      
 
Domain Number 2 Region: 5-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000244
Family GalR/LacI-like bacterial regulator 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145597971|ref|YP_001162047.1|
Sequence length 360
Comment LacI-family regulatory protein [Yersinia pestis Pestoides F]
Sequence
MNGKLKIQEIANQTGLSISTVSRVLAGKGNTSAKAKQQVMAYAKSQGILQNLSSGRLMLN
NIMVFAPHRAFDVRTDIFYYKVIQGITQAVSQHEVMIRYCGLSETHSDISLFLDKMTHPQ
SEAAIIIGIDDPRIHALAASLHKPAVLINCRDKEMSLDSVSPDHQSIGEFSAHYLIQQGH
RRILTLQCLRRNTMELRLLGIKDAFASNNMRFDDHQHLITTHGFGAEEAEQAITTFFTAC
EDESRLPTAILVGGDYMAVGAVNALNKLNVNVPNRVSVMSMDGFNLAEIHDVPLTAVHVP
RDELGAEAIQLLQRRVLRPDAPFSNLLLQGKLVVRSSVKQVNQNRAMPAANKPTDQIYDL
Download sequence
Identical sequences A0A0E1NV59 A0A0E8XGW0 A0A0H2YK82 A0A0H3B0D4 A0A0M1V9E8 A0A0U1EPQ4 A0A208S4Q8 Q0WIJ1 Q667A2 Q7CGW3
gi|145597971|ref|YP_001162047.1| gi|108806421|ref|YP_650337.1| gi|218928022|ref|YP_002345897.1| gi|294502977|ref|YP_003567039.1| gi|384125289|ref|YP_005507903.1| WP_002209890.1.100083 WP_002209890.1.100246 WP_002209890.1.10066 WP_002209890.1.100921 WP_002209890.1.100931 WP_002209890.1.10105 WP_002209890.1.101305 WP_002209890.1.101382 WP_002209890.1.101928 WP_002209890.1.102012 WP_002209890.1.102067 WP_002209890.1.10736 WP_002209890.1.10935 WP_002209890.1.10955 WP_002209890.1.11693 WP_002209890.1.12463 WP_002209890.1.12736 WP_002209890.1.12857 WP_002209890.1.1388 WP_002209890.1.14063 WP_002209890.1.15321 WP_002209890.1.15555 WP_002209890.1.15605 WP_002209890.1.16243 WP_002209890.1.17135 WP_002209890.1.17141 WP_002209890.1.17608 WP_002209890.1.17873 WP_002209890.1.17983 WP_002209890.1.18208 WP_002209890.1.18640 WP_002209890.1.18826 WP_002209890.1.19329 WP_002209890.1.19425 WP_002209890.1.19739 WP_002209890.1.19763 WP_002209890.1.20035 WP_002209890.1.20380 WP_002209890.1.2064 WP_002209890.1.20932 WP_002209890.1.21486 WP_002209890.1.21784 WP_002209890.1.21879 WP_002209890.1.21934 WP_002209890.1.22708 WP_002209890.1.23157 WP_002209890.1.23271 WP_002209890.1.23687 WP_002209890.1.23811 WP_002209890.1.24002 WP_002209890.1.2451 WP_002209890.1.25181 WP_002209890.1.25394 WP_002209890.1.26383 WP_002209890.1.2640 WP_002209890.1.26509 WP_002209890.1.26776 WP_002209890.1.26960 WP_002209890.1.27124 WP_002209890.1.27251 WP_002209890.1.2726 WP_002209890.1.28922 WP_002209890.1.29157 WP_002209890.1.29355 WP_002209890.1.29622 WP_002209890.1.2964 WP_002209890.1.29685 WP_002209890.1.29814 WP_002209890.1.30931 WP_002209890.1.31496 WP_002209890.1.31739 WP_002209890.1.32343 WP_002209890.1.32388 WP_002209890.1.32446 WP_002209890.1.32736 WP_002209890.1.33324 WP_002209890.1.33661 WP_002209890.1.33937 WP_002209890.1.34031 WP_002209890.1.34138 WP_002209890.1.35389 WP_002209890.1.35538 WP_002209890.1.36088 WP_002209890.1.37174 WP_002209890.1.37494 WP_002209890.1.37863 WP_002209890.1.38147 WP_002209890.1.38235 WP_002209890.1.38532 WP_002209890.1.38743 WP_002209890.1.38824 WP_002209890.1.38993 WP_002209890.1.39066 WP_002209890.1.39346 WP_002209890.1.3976 WP_002209890.1.39858 WP_002209890.1.40134 WP_002209890.1.40853 WP_002209890.1.41196 WP_002209890.1.41984 WP_002209890.1.4210 WP_002209890.1.42361 WP_002209890.1.42490 WP_002209890.1.44408 WP_002209890.1.44603 WP_002209890.1.45198 WP_002209890.1.45214 WP_002209890.1.46545 WP_002209890.1.46686 WP_002209890.1.46697 WP_002209890.1.46731 WP_002209890.1.4678 WP_002209890.1.46891 WP_002209890.1.47387 WP_002209890.1.47440 WP_002209890.1.47881 WP_002209890.1.48166 WP_002209890.1.48722 WP_002209890.1.4889 WP_002209890.1.49906 WP_002209890.1.4997 WP_002209890.1.50010 WP_002209890.1.50093 WP_002209890.1.50106 WP_002209890.1.50185 WP_002209890.1.50984 WP_002209890.1.51293 WP_002209890.1.51588 WP_002209890.1.51772 WP_002209890.1.51934 WP_002209890.1.52158 WP_002209890.1.52247 WP_002209890.1.52473 WP_002209890.1.52569 WP_002209890.1.52734 WP_002209890.1.52792 WP_002209890.1.52819 WP_002209890.1.52969 WP_002209890.1.53147 WP_002209890.1.53300 WP_002209890.1.53838 WP_002209890.1.53883 WP_002209890.1.53953 WP_002209890.1.54568 WP_002209890.1.54951 WP_002209890.1.55194 WP_002209890.1.55695 WP_002209890.1.5592 WP_002209890.1.56031 WP_002209890.1.56912 WP_002209890.1.56953 WP_002209890.1.57585 WP_002209890.1.57657 WP_002209890.1.58067 WP_002209890.1.58794 WP_002209890.1.59102 WP_002209890.1.59431 WP_002209890.1.5957 WP_002209890.1.59635 WP_002209890.1.59687 WP_002209890.1.59789 WP_002209890.1.59885 WP_002209890.1.60437 WP_002209890.1.60707 WP_002209890.1.60896 WP_002209890.1.61689 WP_002209890.1.62232 WP_002209890.1.62342 WP_002209890.1.6270 WP_002209890.1.63387 WP_002209890.1.63517 WP_002209890.1.63641 WP_002209890.1.64142 WP_002209890.1.64474 WP_002209890.1.64780 WP_002209890.1.64786 WP_002209890.1.64910 WP_002209890.1.653 WP_002209890.1.65400 WP_002209890.1.65554 WP_002209890.1.6570 WP_002209890.1.65706 WP_002209890.1.65718 WP_002209890.1.6581 WP_002209890.1.66118 WP_002209890.1.66616 WP_002209890.1.67850 WP_002209890.1.6791 WP_002209890.1.68361 WP_002209890.1.68371 WP_002209890.1.68753 WP_002209890.1.68855 WP_002209890.1.69018 WP_002209890.1.69316 WP_002209890.1.69951 WP_002209890.1.70171 WP_002209890.1.70319 WP_002209890.1.70377 WP_002209890.1.70417 WP_002209890.1.70726 WP_002209890.1.7083 WP_002209890.1.7169 WP_002209890.1.71744 WP_002209890.1.72280 WP_002209890.1.72440 WP_002209890.1.72486 WP_002209890.1.7402 WP_002209890.1.74310 WP_002209890.1.74577 WP_002209890.1.74738 WP_002209890.1.75173 WP_002209890.1.7518 WP_002209890.1.75208 WP_002209890.1.75337 WP_002209890.1.75407 WP_002209890.1.75636 WP_002209890.1.75821 WP_002209890.1.76555 WP_002209890.1.77387 WP_002209890.1.77429 WP_002209890.1.77691 WP_002209890.1.7841 WP_002209890.1.78556 WP_002209890.1.79515 WP_002209890.1.79550 WP_002209890.1.79609 WP_002209890.1.79981 WP_002209890.1.8009 WP_002209890.1.80331 WP_002209890.1.81848 WP_002209890.1.81877 WP_002209890.1.8210 WP_002209890.1.82133 WP_002209890.1.82151 WP_002209890.1.82270 WP_002209890.1.82436 WP_002209890.1.82619 WP_002209890.1.8303 WP_002209890.1.83039 WP_002209890.1.83265 WP_002209890.1.83630 WP_002209890.1.8420 WP_002209890.1.84720 WP_002209890.1.85269 WP_002209890.1.8559 WP_002209890.1.85802 WP_002209890.1.86034 WP_002209890.1.86059 WP_002209890.1.87107 WP_002209890.1.8728 WP_002209890.1.87418 WP_002209890.1.8762 WP_002209890.1.87853 WP_002209890.1.87988 WP_002209890.1.88362 WP_002209890.1.88472 WP_002209890.1.89359 WP_002209890.1.8964 WP_002209890.1.9051 WP_002209890.1.90624 WP_002209890.1.91373 WP_002209890.1.92030 WP_002209890.1.92331 WP_002209890.1.92604 WP_002209890.1.927 WP_002209890.1.9311 WP_002209890.1.9320 WP_002209890.1.93623 WP_002209890.1.93928 WP_002209890.1.93933 WP_002209890.1.94052 WP_002209890.1.94201 WP_002209890.1.94683 WP_002209890.1.95746 WP_002209890.1.95981 WP_002209890.1.97245 WP_002209890.1.97448 WP_002209890.1.97791 WP_002209890.1.97864 WP_002209890.1.97872 WP_002209890.1.97894 WP_002209890.1.99109 WP_002209890.1.99383 WP_002209890.1.9941 WP_002209890.1.99416 WP_002209890.1.99882 WP_002209890.1.99990 YP_002345897.1.25044 gi|384121416|ref|YP_005504036.1| gi|45443280|ref|NP_994819.1| gi|22127107|ref|NP_670530.1| gi|384137165|ref|YP_005519867.1| gi|186896513|ref|YP_001873625.1| gi|108813208|ref|YP_648975.1| gi|170023228|ref|YP_001719733.1| gi|51597405|ref|YP_071596.1| gi|162420065|ref|YP_001607705.1| 187410.y3231 214092.YPO0846 229193.YP_3543 273123.YPTB3091 349746.YpAngola_A3362 360102.YPA_0424 377628.YPN_3048 386656.YPDSF_0668 502800.YPK_0979 502801.YPTS_3213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]