SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145598063|ref|YP_001162139.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145598063|ref|YP_001162139.1|
Domain Number 1 Region: 60-340
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.02e-95
Family L-arabinose binding protein-like 0.000000000431
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.25e-16
Family GalR/LacI-like bacterial regulator 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145598063|ref|YP_001162139.1|
Sequence length 341
Comment DNA-binding transcriptional repressor PurR [Yersinia pestis Pestoides F]
Sequence
MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTK
SIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLL
VMCSEYPDQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRD
IGAIPGQLARNTGGGRHQGFLKALEEANIPVREEWIVQGDFEPESGYKAMHQILTQKHRP
TAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGET
AFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR
Download sequence
Identical sequences A0A0E8XG63 A0A0M1V5Y9 A0A0T9JE97 A0A0U1EMW7 A0A154M194 A0A208S128 A4TIQ4 A7FHK2 A9QZB3 B1JJ59 B2K5I4 Q1CIL0 Q66A32 Q7CIS2
gi|162419802|ref|YP_001606983.1| gi|45441965|ref|NP_993504.1| gi|218929478|ref|YP_002347353.1| 187410.y1950 214092.YPO2387 229193.YP_2173 273123.YPTB2300 349746.YpAngola_A2572 349747.YpsIP31758_1755 377628.YPN_1841 386656.YPDSF_0760 502800.YPK_1862 502801.YPTS_2374 gi|22125842|ref|NP_669265.1| gi|51596624|ref|YP_070815.1| WP_002210943.1.100083 WP_002210943.1.100246 WP_002210943.1.100593 WP_002210943.1.10066 WP_002210943.1.100921 WP_002210943.1.100931 WP_002210943.1.10105 WP_002210943.1.101305 WP_002210943.1.101928 WP_002210943.1.102012 WP_002210943.1.102067 WP_002210943.1.10736 WP_002210943.1.10935 WP_002210943.1.10955 WP_002210943.1.11693 WP_002210943.1.12167 WP_002210943.1.12463 WP_002210943.1.12736 WP_002210943.1.1388 WP_002210943.1.14063 WP_002210943.1.14169 WP_002210943.1.15321 WP_002210943.1.15555 WP_002210943.1.15605 WP_002210943.1.15689 WP_002210943.1.16243 WP_002210943.1.17135 WP_002210943.1.17141 WP_002210943.1.17608 WP_002210943.1.17873 WP_002210943.1.17983 WP_002210943.1.18208 WP_002210943.1.18640 WP_002210943.1.18826 WP_002210943.1.19329 WP_002210943.1.19425 WP_002210943.1.19739 WP_002210943.1.20035 WP_002210943.1.20380 WP_002210943.1.20547 WP_002210943.1.2064 WP_002210943.1.20932 WP_002210943.1.21486 WP_002210943.1.21784 WP_002210943.1.21879 WP_002210943.1.21934 WP_002210943.1.22708 WP_002210943.1.23271 WP_002210943.1.23687 WP_002210943.1.23811 WP_002210943.1.24002 WP_002210943.1.2451 WP_002210943.1.24517 WP_002210943.1.25181 WP_002210943.1.25394 WP_002210943.1.26383 WP_002210943.1.2640 WP_002210943.1.26509 WP_002210943.1.26776 WP_002210943.1.26960 WP_002210943.1.27124 WP_002210943.1.27251 WP_002210943.1.28647 WP_002210943.1.28922 WP_002210943.1.29157 WP_002210943.1.29186 WP_002210943.1.29355 WP_002210943.1.2947 WP_002210943.1.29622 WP_002210943.1.2964 WP_002210943.1.29685 WP_002210943.1.29814 WP_002210943.1.3092 WP_002210943.1.30931 WP_002210943.1.311 WP_002210943.1.31496 WP_002210943.1.31721 WP_002210943.1.31739 WP_002210943.1.31805 WP_002210943.1.32343 WP_002210943.1.32388 WP_002210943.1.32446 WP_002210943.1.32736 WP_002210943.1.33203 WP_002210943.1.33324 WP_002210943.1.33661 WP_002210943.1.33937 WP_002210943.1.34031 WP_002210943.1.34138 WP_002210943.1.35389 WP_002210943.1.35538 WP_002210943.1.36088 WP_002210943.1.37174 WP_002210943.1.37494 WP_002210943.1.37863 WP_002210943.1.38147 WP_002210943.1.38235 WP_002210943.1.38532 WP_002210943.1.38743 WP_002210943.1.38824 WP_002210943.1.38993 WP_002210943.1.39066 WP_002210943.1.39346 WP_002210943.1.3976 WP_002210943.1.39858 WP_002210943.1.40134 WP_002210943.1.40534 WP_002210943.1.40853 WP_002210943.1.41196 WP_002210943.1.41984 WP_002210943.1.4210 WP_002210943.1.42361 WP_002210943.1.42490 WP_002210943.1.42976 WP_002210943.1.44408 WP_002210943.1.44598 WP_002210943.1.44603 WP_002210943.1.44832 WP_002210943.1.45198 WP_002210943.1.45214 WP_002210943.1.46262 WP_002210943.1.46545 WP_002210943.1.46686 WP_002210943.1.46697 WP_002210943.1.46731 WP_002210943.1.4678 WP_002210943.1.46891 WP_002210943.1.47387 WP_002210943.1.47440 WP_002210943.1.47769 WP_002210943.1.47881 WP_002210943.1.48166 WP_002210943.1.48722 WP_002210943.1.4889 WP_002210943.1.49315 WP_002210943.1.49906 WP_002210943.1.4997 WP_002210943.1.50010 WP_002210943.1.50093 WP_002210943.1.50106 WP_002210943.1.50185 WP_002210943.1.50984 WP_002210943.1.51284 WP_002210943.1.51293 WP_002210943.1.51588 WP_002210943.1.51772 WP_002210943.1.51934 WP_002210943.1.52158 WP_002210943.1.52247 WP_002210943.1.52473 WP_002210943.1.52569 WP_002210943.1.52734 WP_002210943.1.52792 WP_002210943.1.52819 WP_002210943.1.52969 WP_002210943.1.53147 WP_002210943.1.53300 WP_002210943.1.53838 WP_002210943.1.53848 WP_002210943.1.53883 WP_002210943.1.53953 WP_002210943.1.54568 WP_002210943.1.54951 WP_002210943.1.55194 WP_002210943.1.55695 WP_002210943.1.5592 WP_002210943.1.56031 WP_002210943.1.56912 WP_002210943.1.56953 WP_002210943.1.57585 WP_002210943.1.57657 WP_002210943.1.58543 WP_002210943.1.58794 WP_002210943.1.59102 WP_002210943.1.59431 WP_002210943.1.5957 WP_002210943.1.59635 WP_002210943.1.5968 WP_002210943.1.59687 WP_002210943.1.59789 WP_002210943.1.59885 WP_002210943.1.60707 WP_002210943.1.60896 WP_002210943.1.61689 WP_002210943.1.62232 WP_002210943.1.62342 WP_002210943.1.6270 WP_002210943.1.6333 WP_002210943.1.63387 WP_002210943.1.63517 WP_002210943.1.63641 WP_002210943.1.64142 WP_002210943.1.64474 WP_002210943.1.64780 WP_002210943.1.64786 WP_002210943.1.64910 WP_002210943.1.653 WP_002210943.1.65400 WP_002210943.1.6570 WP_002210943.1.65706 WP_002210943.1.65718 WP_002210943.1.6581 WP_002210943.1.66546 WP_002210943.1.66616 WP_002210943.1.67404 WP_002210943.1.67850 WP_002210943.1.6791 WP_002210943.1.68361 WP_002210943.1.68371 WP_002210943.1.68753 WP_002210943.1.68855 WP_002210943.1.69018 WP_002210943.1.69316 WP_002210943.1.70171 WP_002210943.1.70319 WP_002210943.1.70377 WP_002210943.1.70726 WP_002210943.1.7083 WP_002210943.1.7169 WP_002210943.1.71744 WP_002210943.1.72280 WP_002210943.1.72440 WP_002210943.1.72486 WP_002210943.1.7402 WP_002210943.1.74310 WP_002210943.1.74738 WP_002210943.1.75169 WP_002210943.1.75173 WP_002210943.1.75208 WP_002210943.1.75337 WP_002210943.1.75407 WP_002210943.1.75636 WP_002210943.1.75689 WP_002210943.1.75821 WP_002210943.1.76555 WP_002210943.1.76670 WP_002210943.1.77295 WP_002210943.1.77387 WP_002210943.1.77429 WP_002210943.1.77569 WP_002210943.1.78004 WP_002210943.1.7841 WP_002210943.1.78556 WP_002210943.1.7939 WP_002210943.1.79515 WP_002210943.1.79550 WP_002210943.1.79609 WP_002210943.1.79825 WP_002210943.1.79981 WP_002210943.1.8009 WP_002210943.1.80331 WP_002210943.1.8210 WP_002210943.1.82133 WP_002210943.1.82151 WP_002210943.1.82270 WP_002210943.1.82436 WP_002210943.1.82619 WP_002210943.1.8303 WP_002210943.1.83039 WP_002210943.1.83265 WP_002210943.1.83630 WP_002210943.1.84720 WP_002210943.1.85269 WP_002210943.1.85270 WP_002210943.1.85802 WP_002210943.1.86034 WP_002210943.1.86059 WP_002210943.1.86413 WP_002210943.1.87107 WP_002210943.1.8728 WP_002210943.1.87418 WP_002210943.1.8762 WP_002210943.1.87853 WP_002210943.1.87988 WP_002210943.1.88362 WP_002210943.1.88472 WP_002210943.1.89359 WP_002210943.1.89542 WP_002210943.1.8964 WP_002210943.1.90176 WP_002210943.1.9051 WP_002210943.1.90624 WP_002210943.1.91263 WP_002210943.1.91373 WP_002210943.1.91844 WP_002210943.1.92030 WP_002210943.1.92331 WP_002210943.1.92604 WP_002210943.1.927 WP_002210943.1.9311 WP_002210943.1.9320 WP_002210943.1.93623 WP_002210943.1.93928 WP_002210943.1.93933 WP_002210943.1.94052 WP_002210943.1.94683 WP_002210943.1.95746 WP_002210943.1.95981 WP_002210943.1.97245 WP_002210943.1.97375 WP_002210943.1.97448 WP_002210943.1.97791 WP_002210943.1.97864 WP_002210943.1.97872 WP_002210943.1.97894 WP_002210943.1.99109 WP_002210943.1.99383 WP_002210943.1.9941 WP_002210943.1.99788 WP_002210943.1.99882 WP_002210943.1.99972 WP_002210943.1.99990 YP_002347353.1.25044 gi|294503608|ref|YP_003567670.1| gi|108812003|ref|YP_647770.1| gi|170024101|ref|YP_001720606.1| gi|145598063|ref|YP_001162139.1| gi|384122055|ref|YP_005504675.1| gi|186895680|ref|YP_001872792.1| gi|153949862|ref|YP_001400730.1| gi|384139786|ref|YP_005522488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]