SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145598409|ref|YP_001162485.1| from Yersinia pestis Pestoides F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145598409|ref|YP_001162485.1|
Domain Number 1 Region: 3-197
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000824
Family L-arabinose binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145598409|ref|YP_001162485.1|
Sequence length 218
Comment hypothetical protein YPDSF_1114 [Yersinia pestis Pestoides F]
Sequence
MLAATAKHLTTYPTTWRLCDNDEDYVIWLLPLLTSHGQDAVAIEHDCSVHGKSVAHQLSA
SIKPAEDPQQAATTFFAGSFSYALERAANWAHDSPEGARLILADDAFSAELVPALLARGI
DLGSRQIYVAAIAPQPIGEKASTLASAWHQRWGGTPGGYFWETMAALQVASQYPDFPAQT
LLGALNFDAQHESHPASFSLWLATHRGLQIVLTPEVSI
Download sequence
Identical sequences gi|145598409|ref|YP_001162485.1| 386656.YPDSF_1114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]